DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and pxna

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_963882.1 Gene:pxna / 399546 ZFINID:ZDB-GENE-040105-1 Length:533 Species:Danio rerio


Alignment Length:170 Identity:61/170 - (35%)
Similarity:97/170 - (57%) Gaps:1/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            ||..|::.|..:::||:|:|||||||:|..|.|:|....|..:.|:|.|.|.:...::..|..|.
Zfish   299 VCGACKKPIAGQVVTAMGRTWHPEHFVCTQCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCS 363

  Fly    71 KPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITD 135
            .|||:|.:.|:.:.||...|.| ..|......:.|:|::||.||::||.::||.:|..|.:.|.:
Zfish   364 GPILDKVVTALDKTWHPEHFFC-AQCGSFFGPEGFHEKEGKAYCRKDYFDMFAPKCGGCARAILE 427

  Fly   136 SAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPA 175
            :.:.|:|..||..||.|.:|..|..:.:|.....:|.|.|
Zfish   428 NYISALNSLWHPECFVCRECFTPFVNGSFFEHEGQPYCEA 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 22/50 (44%)
LIM 66..118 CDD:351770 18/51 (35%)
LIM 125..176 CDD:214528 16/51 (31%)
pxnaNP_963882.1 Paxillin 54..229 CDD:281527
LIM1_Paxillin_like 300..352 CDD:259830 22/51 (43%)
LIM2_Paxillin 359..410 CDD:188791 18/51 (35%)
LIM3_Paxillin 418..470 CDD:188793 16/50 (32%)
LIM4_Paxillin 477..528 CDD:188795
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583867
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D249616at33208
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.