| Sequence 1: | NP_001163031.1 | Gene: | CG31624 / 35393 | FlyBaseID: | FBgn0051624 | Length: | 178 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001358423.1 | Gene: | LIMS1 / 3987 | HGNCID: | 6616 | Length: | 398 | Species: | Homo sapiens |
| Alignment Length: | 234 | Identity: | 66/234 - (28%) |
|---|---|---|---|
| Similarity: | 89/234 - (38%) | Gaps: | 65/234 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQS-----------------GEPVC 54
Fly 55 NKCFV-------------------------------------ERYTY---------TCAGCKKPI 73
Fly 74 LEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITDSAV 138
Fly 139 LAMNVKWHRNCFQCNKCENPITSQTFTIDGD-KPVCPAC 176 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31624 | NP_001163031.1 | LIM | 7..58 | CDD:351770 | 21/67 (31%) |
| LIM | 66..118 | CDD:351770 | 20/51 (39%) | ||
| LIM | 125..176 | CDD:214528 | 18/51 (35%) | ||
| LIMS1 | NP_001358423.1 | LIM1_PINCH | 72..130 | CDD:188717 | |
| LIM2_PINCH | 133..184 | CDD:188718 | 18/50 (36%) | ||
| LIM3_PINCH | 197..247 | CDD:188719 | 5/49 (10%) | ||
| LIM4_PINCH | 253..306 | CDD:188720 | 20/53 (38%) | ||
| LIM5_PINCH | 314..367 | CDD:188721 | 19/52 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X39 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||