DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and fhl1b

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_954687.1 Gene:fhl1b / 387528 ZFINID:ZDB-GENE-031219-1 Length:280 Species:Danio rerio


Alignment Length:174 Identity:56/174 - (32%)
Similarity:83/174 - (47%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAIT--KRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            |.:|:..|:  .:.:...||.||.:.|.|..|.:.:...:|..:....:|..|........|.||
Zfish    40 CTECRRTISTDSKELHHKGKYWHSDCFRCAKCYKNLAKESFTSKDDRILCGTCSSREDAPRCHGC 104

  Fly    70 KKPILEKT--ICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKP 132
            .||||..|  :...|..||:.||.| ..|:||:.:::|..::...||...:|..||.:||.|:||
Zfish   105 YKPILPGTENVEYKGNSWHDECFKC-YQCQKPIGNKSFITKNNNVYCSPCHEKKFAKQCACCKKP 168

  Fly   133 ITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            ||...|...:..||..||.|:.|..|:....||...:|..|..|
Zfish   169 ITTGGVNYQDQPWHSECFVCSSCRKPLAGTRFTSHEEKVYCVDC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 12/52 (23%)
LIM 66..118 CDD:351770 20/53 (38%)
LIM 125..176 CDD:214528 19/50 (38%)
fhl1bNP_954687.1 LIM1_FHL1 40..93 CDD:188730 12/52 (23%)
LIM2_FHL1 101..158 CDD:188808 21/57 (37%)
LIM3_FHL1 162..214 CDD:188813 20/51 (39%)
LIM4_FHL1 217..280 CDD:188734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11189
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4575
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.