Sequence 1: | NP_001163031.1 | Gene: | CG31624 / 35393 | FlyBaseID: | FBgn0051624 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_954687.1 | Gene: | fhl1b / 387528 | ZFINID: | ZDB-GENE-031219-1 | Length: | 280 | Species: | Danio rerio |
Alignment Length: | 174 | Identity: | 56/174 - (32%) |
---|---|---|---|
Similarity: | 83/174 - (47%) | Gaps: | 5/174 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 CHKCQEAIT--KRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
Fly 70 KKPILEKT--ICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKP 132
Fly 133 ITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31624 | NP_001163031.1 | LIM | 7..58 | CDD:351770 | 12/52 (23%) |
LIM | 66..118 | CDD:351770 | 20/53 (38%) | ||
LIM | 125..176 | CDD:214528 | 19/50 (38%) | ||
fhl1b | NP_954687.1 | LIM1_FHL1 | 40..93 | CDD:188730 | 12/52 (23%) |
LIM2_FHL1 | 101..158 | CDD:188808 | 21/57 (37%) | ||
LIM3_FHL1 | 162..214 | CDD:188813 | 20/51 (39%) | ||
LIM4_FHL1 | 217..280 | CDD:188734 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 54 | 1.000 | Domainoid score | I11189 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 133 | 1.000 | Inparanoid score | I4575 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.960 |