DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Fhl4

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001013190.2 Gene:Fhl4 / 314678 RGDID:1308978 Length:280 Species:Rattus norvegicus


Alignment Length:175 Identity:57/175 - (32%)
Similarity:84/175 - (48%) Gaps:5/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAI--TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAG 68
            :|.:|.:.|  ..:.:....:.||...|.|..|.:.:...||.|...:.:||.|..::....|.|
  Rat    38 ICVECNKPIGADSKEVCYKERFWHNTCFKCSKCLQPLATETFVVWDNKILCNNCVSQQAFPKCKG 102

  Fly    69 CKKPIL--EKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEK 131
            |.|.|.  |:::...|..||:.||.|.. ||:.:.::||:.:|...||...|:.||...|.||.|
  Rat   103 CLKDIKQGEQSVEYKGTIWHKDCFVCSN-CKEVIGTKTFFPKDEGFYCVACYDILFTKYCVKCNK 166

  Fly   132 PITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            |||...|...:..||..||.|..|...::.|.||:..||..|..|
  Rat   167 PITSGGVSYQDQPWHSECFVCVNCSKELSEQRFTVMDDKIFCVDC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 13/52 (25%)
LIM 66..118 CDD:351770 19/53 (36%)
LIM 125..176 CDD:214528 20/50 (40%)
Fhl4NP_001013190.2 LIM 39..91 CDD:413332 13/51 (25%)
LIM 100..157 CDD:413332 20/57 (35%)
LIM 161..213 CDD:413332 21/51 (41%)
LIM 216..279 CDD:413332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10711
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.