DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Fhl3

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001101449.1 Gene:Fhl3 / 313582 RGDID:1307180 Length:288 Species:Rattus norvegicus


Alignment Length:174 Identity:61/174 - (35%)
Similarity:88/174 - (50%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI--TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            |.:||:.|  ..|.:....:.:|...|.|..|...:.|..|..|..|.:||:|:...::..|:.|
  Rat    40 CAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQCSAC 104

  Fly    70 KKPIL--EKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKP 132
            .:.::  .:.:...|:.|||.||.|.| |::||.|::|....|..||...|||.||.|||:|.|.
  Rat   105 GETVMPGSRKLEYGGQTWHEHCFLCSG-CEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKT 168

  Fly   133 ITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            :|...|...:..|||.|..|..|:.|:..|.||...|.|.|.||
  Rat   169 LTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDDDPYCVAC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 15/52 (29%)
LIM 66..118 CDD:351770 18/53 (34%)
LIM 125..176 CDD:214528 20/50 (40%)
Fhl3NP_001101449.1 LIM <5..33 CDD:413332
LIM1_FHL3 36..94 CDD:188807 16/53 (30%)
LIM2_FHL3 98..155 CDD:188811 18/57 (32%)
LIM3_FHL 162..213 CDD:188732 21/51 (41%)
LIM 221..284 CDD:413332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10711
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104605
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.