DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Lpxn

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_038964643.1 Gene:Lpxn / 293783 RGDID:1304981 Length:398 Species:Rattus norvegicus


Alignment Length:168 Identity:62/168 - (36%)
Similarity:101/168 - (60%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKK 71
            |..||:.|..::|.|||::||||||:|.||.|::..:.|..::|...|:|.:...::..||.|..
  Rat   164 CASCQKPIAGKVIHALGQSWHPEHFVCTHCKEELGSSPFFERNGLAYCSKDYHHLFSPRCAYCAA 228

  Fly    72 PILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITDS 136
            ||.:|.:.||.:.||...|.| ..|.:...::.|:|:|.||||::|:..:|:.:|..|.:|:.::
  Rat   229 PITDKVLTAMNKTWHPEHFFC-SHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLEN 292

  Fly   137 AVLAMNVKWHRNCFQCNKCENPITSQT-FTIDGDKPVC 173
            .:.|||..||..||.|..|.:..:|.: |.:|| :|.|
  Rat   293 YLSAMNTVWHPECFVCGDCFSSFSSGSFFELDG-RPFC 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 22/50 (44%)
LIM 66..118 CDD:351770 20/51 (39%)
LIM 125..176 CDD:214528 18/50 (36%)
LpxnXP_038964643.1 LIM1_Leupaxin 162..216 CDD:188790 22/51 (43%)
LIM 223..274 CDD:413332 20/51 (39%)
LIM 282..334 CDD:413332 18/49 (37%)
LIM4_Paxillin_like 341..392 CDD:188725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343619
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D249616at33208
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.