DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Pdlim7

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_038951356.1 Gene:Pdlim7 / 286908 RGDID:628769 Length:464 Species:Rattus norvegicus


Alignment Length:170 Identity:64/170 - (37%)
Similarity:93/170 - (54%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            |||:|.:.|..|.:.|||..:|||.|:|..|.:.:.:..|..:.|...|..|:..||..:||.||
  Rat   288 VCHQCHKIIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPSCYDVRYAPSCAKCK 352

  Fly    71 KPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPIT- 134
            |.|..:.:.|:...||..||.| .|||.|:.::.||..:|.|||::|||.:|..:|..|:..|. 
  Rat   353 KKITGEIMHALKMTWHVPCFTC-AACKTPIRNRAFYMEEGAPYCERDYEKMFGTKCRGCDFKIDA 416

  Fly   135 -DSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVC 173
             |..:.|:...||..||.|..|:..:..:||....|||:|
  Rat   417 GDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDKPLC 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 17/50 (34%)
LIM 66..118 CDD:351770 22/51 (43%)
LIM 125..176 CDD:214528 17/51 (33%)
Pdlim7XP_038951356.1 PDZ_signaling 5..79 CDD:238492
PHA03247 <11..261 CDD:223021
DUF4749 <163..192 CDD:406377
LIM1_Enigma 289..340 CDD:188836 17/50 (34%)
LIM2_Enigma 348..399 CDD:188840 22/51 (43%)
LIM3_Enigma 407..461 CDD:188842 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.