DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and PDLIM3

DIOPT Version :10

Sequence 1:NP_724318.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_055291.2 Gene:PDLIM3 / 27295 HGNCID:20767 Length:364 Species:Homo sapiens


Alignment Length:67 Identity:19/67 - (28%)
Similarity:27/67 - (40%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|.||...|...::.|..|..|||.|:|..|:..:....:....||..|.       |:..|..|
Human   293 LCDKCGSGIVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFIEGELYCE-------THARARTK 350

  Fly    71 KP 72
            .|
Human   351 PP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_724318.1 LIM 7..58 CDD:413332 15/50 (30%)
LIM 66..118 CDD:413332 3/7 (43%)
LIM 125..176 CDD:214528
PDLIM3NP_055291.2 PDZ_PDLIM-like 4..82 CDD:467235
DUF4749 184..272 CDD:464948
LIM_ALP 294..346 CDD:188834 16/58 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.