DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and rga1

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_596743.1 Gene:rga1 / 2541022 PomBaseID:SPBC3F6.05 Length:1150 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:54/182 - (29%)
Similarity:80/182 - (43%) Gaps:15/182 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTESIVCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQIL-------DATFNVQSGEPVCNKCF 58
            ::.|.:|..|.:.|:.:.:.|||..:|.|.|.||.|:..:.       |.|.|.|  .|:|...:
pombe   110 VSSSKICASCGQVISGQYVRALGNIYHLECFRCHDCNSLVASKFFPIDDPTLNKQ--VPLCETDY 172

  Fly    59 VERYTYTCAGCKKPILEKTICAMGERWHEACFCCGGACKKPLA-SQTFYERDGKPYCKQDYENLF 122
            ..|....||.|...:....|.|:.:::|...|.| ..|..... :.::||.:||.||...|..||
pombe   173 FRRLDLLCASCGMALRGYYITALNKKFHIEHFTC-SLCYTVFGPNDSYYEYEGKVYCHYHYSTLF 236

  Fly   123 AARCAKCEKPITDSAV----LAMNVKWHRNCFQCNKCENPITSQTFTIDGDK 170
            ||||..|:.||....|    ..::..||..|....|..|....|..:|:..|
pombe   237 AARCCGCDGPILRQFVEVYRNGVSQNWHVPCHMIYKFWNVKLCQKTSIETSK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 18/57 (32%)
LIM 66..118 CDD:351770 15/52 (29%)
LIM 125..176 CDD:214528 14/50 (28%)
rga1NP_596743.1 LIM1_Lrg1p_like 116..172 CDD:188777 18/57 (32%)
LIM2_Lrg1p_like 180..232 CDD:188778 15/52 (29%)
LIM 485..539 CDD:295319
RhoGAP_fLRG1 835..1044 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.