DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and pxl1

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_596112.1 Gene:pxl1 / 2540856 PomBaseID:SPBC4F6.12 Length:438 Species:Schizosaccharomyces pombe


Alignment Length:177 Identity:48/177 - (27%)
Similarity:84/177 - (47%) Gaps:13/177 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI-TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            ||.|..:: ..|:|:|.||..||:.|.|..|.:.:....|..:.|:..|:..:.|:::..|..||
pombe   258 CHSCGGSLRAGRIISASGKKLHPQCFKCDTCSQNLEHVGFYYREGKFYCHLDYHEQFSPRCKHCK 322

  Fly    71 KPILEKTICAMGERWHEACFCCGGACKKPLASQTF------YERDGKPYCKQDYENLFAARCAKC 129
            .||.::.:....:.:||....|.|      .|:.|      ..||...:|:..|:|.:|.:|.||
pombe   323 TPIEDQAVHINNDWFHENHHFCAG------CSEVFNVNIPCIYRDDLYWCQTCYDNKYAVKCKKC 381

  Fly   130 EKPITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            .|||...:|...:.::|..|:.|..|...:..:.:.:..:.|:|..|
pombe   382 RKPILGISVKGSDGEYHSQCWTCGACNALLGDEGYFMIENTPICRPC 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 16/51 (31%)
LIM 66..118 CDD:351770 14/57 (25%)
LIM 125..176 CDD:214528 13/50 (26%)
pxl1NP_596112.1 LIM 258..314 CDD:278823 17/55 (31%)
LIM 318..370 CDD:259829 14/57 (25%)
LIM 378..428 CDD:259829 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3371
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.