DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and CG30178

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster


Alignment Length:176 Identity:71/176 - (40%)
Similarity:109/176 - (61%) Gaps:2/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTESIVCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYT 65
            |:.||.| :|.|.|..|.:.:||||:||.||.|..|...:....|.....:.||::|:::::...
  Fly     1 MSASICC-RCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAAR 64

  Fly    66 CAGCKKPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCE 130
            |:.|:.||||:.:.|...:|||.||.| .:|.|.|.|.:|:|.:|..:||..:..||::|||.||
  Fly    65 CSACRTPILERGVAAAERKWHEKCFRC-VSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCE 128

  Fly   131 KPITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            |||...||:|::.|||..||:|:.|...|:::.|.|:..:|:|.||
  Fly   129 KPIDRRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 18/50 (36%)
LIM 66..118 CDD:351770 22/51 (43%)
LIM 125..176 CDD:214528 23/50 (46%)
CG30178NP_726395.1 LIM 6..61 CDD:295319 19/55 (35%)
LIM 65..116 CDD:259829 22/51 (43%)
LIM 124..171 CDD:295319 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449841
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 1 0.900 - - E1_KOG1703
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D249616at33208
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
98.800

Return to query results.
Submit another query.