DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Ldb3

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_036048.3 Gene:Ldb3 / 24131 MGIID:1344412 Length:723 Species:Mus musculus


Alignment Length:170 Identity:59/170 - (34%)
Similarity:89/170 - (52%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|..|...|....:.|:|::||||.|.|.:|...:.|..|..:.....|.:|:.:.:...||.|.
Mouse   546 LCGHCNNVIRGPFLVAMGRSWHPEEFNCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPICAKCN 610

  Fly    71 KPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPIT- 134
            ..|:.:.:.|:.:.||..||.| .|||||..:..|:..||:|||::||.|||:.:|..|:.|:. 
Mouse   611 TKIMGEVMHALRQTWHTTCFVC-AACKKPFGNSLFHMEDGEPYCEKDYINLFSTKCHGCDFPVEA 674

  Fly   135 -DSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVC 173
             |..:.|:...||..||.|..|...:..|.|....|||:|
Mouse   675 GDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKDKPLC 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 15/50 (30%)
LIM 66..118 CDD:351770 21/51 (41%)
LIM 125..176 CDD:214528 17/51 (33%)
Ldb3NP_036048.3 PDZ_signaling 5..81 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..193
DUF4749 191..293 CDD:374237
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..423
PHA03247 <378..528 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..525
LIM1_ZASP_Cypher 547..598 CDD:188838 15/50 (30%)
LIM2_Enigma_like 606..657 CDD:188748 21/51 (41%)
LIM3_ZASP_Cypher 665..719 CDD:188844 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.