DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and FHL3

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_004459.2 Gene:FHL3 / 2275 HGNCID:3704 Length:280 Species:Homo sapiens


Alignment Length:174 Identity:60/174 - (34%)
Similarity:87/174 - (50%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI--TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            |.:||:.|  ..|.:....:.:|...|.|..|...:.|..|..|..|.:||.|:...::..|:.|
Human    40 CAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSAC 104

  Fly    70 KKPIL--EKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKP 132
            .:.::  .:.:...|:.|||.||.|.| |::||.|::|....|..||...|||.||.|||:|.|.
Human   105 GETVMPGSRKLEYGGQTWHEHCFLCSG-CEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKT 168

  Fly   133 ITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            :|...|...:..|||.|..|..|:.|:..|.||...:.|.|.||
Human   169 LTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVAC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 15/52 (29%)
LIM 66..118 CDD:351770 18/53 (34%)
LIM 125..176 CDD:214528 19/50 (38%)
FHL3NP_004459.2 LIM <5..33 CDD:295319
LIM1_FHL3 36..94 CDD:188807 16/53 (30%)
LIM2_FHL3 98..155 CDD:188811 18/57 (32%)
LIM3_FHL 162..213 CDD:188732 20/51 (39%)
LIM4_FHL3 221..276 CDD:188818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104605
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.