DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Lims2

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001366066.1 Gene:Lims2 / 225341 MGIID:2385067 Length:341 Species:Mus musculus


Alignment Length:172 Identity:53/172 - (30%)
Similarity:84/172 - (48%) Gaps:3/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|.:|..||.::.:......:||:||.|.:|.:::......:: ||..|..|..:.....|..|:
Mouse   139 ICQRCHLAIDEQPLMFKNDPYHPDHFSCSNCGKELTSDARELK-GELYCLPCHDKMGIPICGACR 202

  Fly    71 KPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITD 135
            :||..:.:.|:|::||...|.| ..|:||......||:.|..||:..|..||...|..|...|..
Mouse   203 RPIEGRVVNALGKQWHVEHFVC-AKCEKPFLGHRHYEKKGLAYCETHYNQLFGDVCYNCSHVIEG 266

  Fly   136 SAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGD-KPVCPAC 176
            ..|.|::..|..|||.|:.|...:|.:...::.| ||||..|
Mouse   267 DVVSALSKAWCVNCFSCSTCNMKLTLKNKFVEFDMKPVCKRC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 13/50 (26%)
LIM 66..118 CDD:351770 18/51 (35%)
LIM 125..176 CDD:214528 17/51 (33%)
Lims2NP_001366066.1 LIM1_PINCH 15..73 CDD:188717
LIM2_PINCH 76..127 CDD:188718
LIM3_PINCH 140..190 CDD:188719 13/50 (26%)
LIM4_PINCH 196..249 CDD:188720 18/53 (34%)
LIM5_PINCH 257..310 CDD:188721 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.