DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Tgfb1i1

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_036008777.1 Gene:Tgfb1i1 / 21804 MGIID:102784 Length:496 Species:Mus musculus


Alignment Length:168 Identity:65/168 - (38%)
Similarity:102/168 - (60%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|..|.:.|..:::||||:.||||||||..|...:..::|..:.|.|.|.:|:.||::..|..|.
Mouse   262 LCGSCNKPIAGQVVTALGRAWHPEHFLCSGCSTTLGGSSFFEKDGAPFCPECYFERFSPRCGFCN 326

  Fly    71 KPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITD 135
            :||..|.:.|:|..||...||| .:|.:|...:.|:||:|:|||::|:..|||.||..|:.||.|
Mouse   327 QPIRHKMVTALGTHWHPEHFCC-VSCGEPFGEEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILD 390

  Fly   136 SAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVC 173
            :.:.|::..||.:||.|.:|..|.:..:|.....:|:|
Mouse   391 NYISALSALWHPDCFVCRECLAPFSGGSFFEHEGRPLC 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 20/50 (40%)
LIM 66..118 CDD:351770 21/51 (41%)
LIM 125..176 CDD:214528 17/49 (35%)
Tgfb1i1XP_036008777.1 Paxillin 4..>128 CDD:397550
LIM1_Paxillin_like 263..315 CDD:259830 21/51 (41%)
LIM2_Paxillin_like 322..373 CDD:188723 21/51 (41%)
LIM 381..433 CDD:413332 16/48 (33%)
LIM4_Leupaxin 440..491 CDD:188796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D249616at33208
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.