DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Pxn

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006530265.1 Gene:Pxn / 19303 MGIID:108295 Length:1088 Species:Mus musculus


Alignment Length:168 Identity:63/168 - (37%)
Similarity:96/168 - (57%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            ||..|::.|..:::||:|||||||||:|.||.|:|....|..:.|:|.|.|.:...::..|..|.
Mouse   854 VCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCN 918

  Fly    71 KPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITD 135
            .|||:|.:.|:...||...|.| ..|......:.|:|:|||.||::||.::||.:|..|.:.|.:
Mouse   919 GPILDKVVTALDRTWHPEHFFC-AQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILE 982

  Fly   136 SAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVC 173
            :.:.|:|..||..||.|.:|..|..:.:|.....:|.|
Mouse   983 NYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYC 1020

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 24/50 (48%)
LIM 66..118 CDD:351770 19/51 (37%)
LIM 125..176 CDD:214528 15/49 (31%)
PxnXP_006530265.1 Paxillin 54..253 CDD:367550
LIM1_Paxillin_like 855..907 CDD:259830 24/51 (47%)
LIM2_Paxillin 914..965 CDD:188791 19/51 (37%)
LIM3_Paxillin_like 973..1025 CDD:188724 15/48 (31%)
LIM4_Paxillin 1032..1083 CDD:188795
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D249616at33208
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.