DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and C34B2.4

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_492793.1 Gene:C34B2.4 / 183192 WormBaseID:WBGene00016389 Length:131 Species:Caenorhabditis elegans


Alignment Length:147 Identity:41/147 - (27%)
Similarity:56/147 - (38%) Gaps:37/147 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI-TKRMITALGKTWHPEHFLCHHCDEQILDATFNV-QSGEPVCNKCFVERYTYTCAGC 69
            |..|...| .:..|.|.||.||..|.||..|..:|.|....| |:|..:|::|.::.....|.||
 Worm     4 CGHCSVKIGEESAILANGKVWHVNHLLCDLCKCRINDGERCVPQNGVILCSECHIKTTRPICKGC 68

  Fly    70 KKPILEKTIC-AMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPI 133
            .: .::...| |:...||..||.| ..|:|||              |.|:..|....|.      
 Worm    69 GE-FIKTNFCEALNSTWHPTCFQC-SVCQKPL--------------KVDFHQLPNRMCV------ 111

  Fly   134 TDSAVLAMNVKWHRNCF 150
                        |.:||
 Worm   112 ------------HSDCF 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 19/52 (37%)
LIM 66..118 CDD:351770 15/52 (29%)
LIM 125..176 CDD:214528 4/26 (15%)
C34B2.4NP_492793.1 LIM 4..57 CDD:259829 19/52 (37%)
LIM 65..>97 CDD:295319 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161131
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1158670at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.