powered by:
Protein Alignment CG31624 and unc-95
DIOPT Version :9
Sequence 1: | NP_001163031.1 |
Gene: | CG31624 / 35393 |
FlyBaseID: | FBgn0051624 |
Length: | 178 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_740934.2 |
Gene: | unc-95 / 173301 |
WormBaseID: | WBGene00006824 |
Length: | 350 |
Species: | Caenorhabditis elegans |
Alignment Length: | 64 |
Identity: | 19/64 - (29%) |
Similarity: | 32/64 - (50%) |
Gaps: | 7/64 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 VCHKCQEAITKRMITAL------GKTWHPEHFLCHHCDEQI-LDATFNVQSGEPVCNKCFVERY 62
||..|.|.|...::||| .:.:|..||:|.:|.:.: :..|:.....:|.|:.||.:.|
Worm 269 VCAYCSEEIDGAILTALAPNSERAQKFHTYHFMCTYCQKALNMHGTYREHDLKPYCHDCFYKLY 332
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1703 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000055 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.