DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and unc-95

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_740934.2 Gene:unc-95 / 173301 WormBaseID:WBGene00006824 Length:350 Species:Caenorhabditis elegans


Alignment Length:64 Identity:19/64 - (29%)
Similarity:32/64 - (50%) Gaps:7/64 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITAL------GKTWHPEHFLCHHCDEQI-LDATFNVQSGEPVCNKCFVERY 62
            ||..|.|.|...::|||      .:.:|..||:|.:|.:.: :..|:.....:|.|:.||.:.|
 Worm   269 VCAYCSEEIDGAILTALAPNSERAQKFHTYHFMCTYCQKALNMHGTYREHDLKPYCHDCFYKLY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 15/57 (26%)
LIM 66..118 CDD:351770
LIM 125..176 CDD:214528
unc-95NP_740934.2 LIM4_Paxillin_like 270..328 CDD:188725 15/57 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.