DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Fhl4

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_034344.2 Gene:Fhl4 / 14202 MGIID:1338765 Length:279 Species:Mus musculus


Alignment Length:176 Identity:57/176 - (32%)
Similarity:80/176 - (45%) Gaps:7/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAI--TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTY-TCA 67
            :|.:|.:.|  ..:.:....:.||...|.|..|.:.:...||.......:|||| ..|.|: .|.
Mouse    38 ICQECHKPIGADSKEVCYKEQFWHNTCFKCSKCSQLLATETFVAWDKNILCNKC-ATRVTFPKCK 101

  Fly    68 GCKKPILE--KTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCE 130
            ||.|.|.|  ..:...|..||:.||.|.. ||..:.::.|:.:|...||...|:.||...|.||:
Mouse   102 GCLKDIEEGDHNVEYKGSIWHKNCFVCTN-CKDIIGTKNFFPKDEGFYCVTCYDALFTKHCMKCK 165

  Fly   131 KPITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPAC 176
            ||||...|...:..||..||.|..|...::.|.||...|:..|..|
Mouse   166 KPITSGGVSYQDQPWHSECFVCVSCSKELSGQRFTAMDDQYFCVDC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 13/52 (25%)
LIM 66..118 CDD:351770 18/53 (34%)
LIM 125..176 CDD:214528 19/50 (38%)
Fhl4NP_034344.2 LIM <4..32 CDD:295319
LIM 39..92 CDD:295319 14/53 (26%)
LIM2_FHL1 100..157 CDD:188808 19/57 (33%)
LIM3_FHL1 161..213 CDD:188813 20/51 (39%)
LIM4_FHL1 216..279 CDD:188734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4604
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.