DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and Lpxn

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_598913.1 Gene:Lpxn / 107321 MGIID:2147677 Length:386 Species:Mus musculus


Alignment Length:168 Identity:63/168 - (37%)
Similarity:101/168 - (60%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKK 71
            |..||:.|..::|.|||::||||||:|.||.|::..:.|..:||...|:|.:...::..||.|..
Mouse   152 CASCQKPIAGKVIHALGQSWHPEHFVCTHCKEELGSSPFFERSGLAYCSKDYHRLFSPRCAYCAA 216

  Fly    72 PILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITDS 136
            ||.:|.:.||.:.||...|.| ..|.:...::.|:|:|.||||::|:..:|:.:|..|.:|:.::
Mouse   217 PITDKVLTAMNKTWHPEHFFC-SHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLEN 280

  Fly   137 AVLAMNVKWHRNCFQCNKCENPITSQT-FTIDGDKPVC 173
            .:.|||..||..||.|..|.:..:|.: |.:|| :|.|
Mouse   281 YLSAMNTVWHPECFVCGDCFSSFSSGSFFELDG-RPFC 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 23/50 (46%)
LIM 66..118 CDD:351770 20/51 (39%)
LIM 125..176 CDD:214528 18/50 (36%)
LpxnNP_598913.1 LD motif 1 3..15
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..52
LD motif 2 70..82
LD motif 3 92..103
LIM 150..204 CDD:295319 23/51 (45%)
LIM 211..262 CDD:295319 20/51 (39%)
LIM 270..322 CDD:295319 18/49 (37%)
LIM4_Paxillin_like 329..380 CDD:188725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839779
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D249616at33208
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.