DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and prickle3

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_031747016.1 Gene:prickle3 / 100490600 XenbaseID:XB-GENE-940034 Length:571 Species:Xenopus tropicalis


Alignment Length:168 Identity:50/168 - (29%)
Similarity:72/168 - (42%) Gaps:20/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMI------TALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTY 64
            ||.:|...|:...:      ..||..|||:.|.|..|.|.:.|..:..|.|:..|.:...|....
 Frog   206 VCQQCGHQISVGDVAVFASRAGLGFCWHPQCFTCAQCLELLCDLIYFYQDGKVYCGRHHAELKRP 270

  Fly    65 TCAGCKKPI--LEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCA 127
            .|..|.:.|  ||.| .|.|..||...||| ..|:.||....:..:|.:|:|...|:.|:|..|.
 Frog   271 RCLACDEVIFSLECT-QAEGFHWHTRHFCC-FECECPLGGHRYIMKDQRPFCCSCYDRLYAQYCD 333

  Fly   128 KCEKPITDSAVLAMN--------VKWH--RNCFQCNKC 155
            .|.:.|....:|.::        ..||  .:||.|.:|
 Frog   334 SCGECIDGLFLLGIDEGQLTYGGQHWHASESCFCCGRC 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 16/56 (29%)
LIM 66..118 CDD:351770 19/53 (36%)
LIM 125..176 CDD:214528 10/41 (24%)
prickle3XP_031747016.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.