DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31624 and fhl2

DIOPT Version :9

Sequence 1:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001120233.1 Gene:fhl2 / 100145283 XenbaseID:XB-GENE-969632 Length:279 Species:Xenopus tropicalis


Alignment Length:215 Identity:62/215 - (28%)
Similarity:94/215 - (43%) Gaps:38/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTESIVCHKCQEAI----------------------------TKRMITALGKT-------WHPEH 30
            |||...||.|:|::                            .|:.|...||.       ||...
 Frog     1 MTERFDCHYCKESLFGKKYLLREENPYCVKCYESLYSNSCEECKKPIGCDGKDLSYKDRHWHESC 65

  Fly    31 FLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKKPILEKT--ICAMGERWHEACFCCG 93
            |.|..|.:.::|..|..:....:|.:|:...|:..|:.|||.|:..|  :...|..|||.||.| 
 Frog    66 FHCFQCKKSLVDKPFAAKDEHLICTECYSNEYSSKCSECKKTIMPGTRKMEYKGNSWHETCFIC- 129

  Fly    94 GACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCEKPITDSAVLAMNVKWHRNCFQCNKCENP 158
            ..|::|:.:::|..:|.:.:|...||..||..|.:|:|.||...|...:..||:.||.|..|:.|
 Frog   130 SRCQQPIGTKSFIPKDNQNFCVACYEKQFAMHCVQCKKAITTGGVTYRDQPWHKECFICTGCKKP 194

  Fly   159 ITSQTFTIDGDKPVCPACNC 178
            ::.|.||...:...|..|.|
 Frog   195 LSGQRFTSRDEFAYCLNCFC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31624NP_001163031.1 LIM 7..58 CDD:351770 16/85 (19%)
LIM 66..118 CDD:351770 18/53 (34%)
LIM 125..176 CDD:214528 17/50 (34%)
fhl2NP_001120233.1 LIM <5..33 CDD:413332 4/27 (15%)
LIM1_FHL2 36..97 CDD:188806 13/60 (22%)
LIM2_FHL2 101..157 CDD:188810 20/56 (36%)
LIM3_Fhl2 162..218 CDD:188815 19/53 (36%)
LIM4_FHL2 221..278 CDD:188817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.