DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq3 and prmt-6

DIOPT Version :9

Sequence 1:NP_610092.2 Gene:Coq3 / 35383 FlyBaseID:FBgn0032922 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_500168.2 Gene:prmt-6 / 182821 WormBaseID:WBGene00016023 Length:252 Species:Caenorhabditis elegans


Alignment Length:153 Identity:46/153 - (30%)
Similarity:74/153 - (48%) Gaps:24/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RDGIVSRGTVKPGYVNTTKVLLGQNILEVGCGGGLLTEHLARLGA-QVAGIDLGEKLIEAAREHL 137
            ||.::: .|:|..:.:   :|:|:.:|:||||.|..:....|.|| :|.|:|..|::|:..:   
 Worm    19 RDHLIT-PTIKKAFGH---ILVGKEVLDVGCGNGHYSFDFLRWGAHKVFGVDNSEEMIQICK--- 76

  Fly   138 KCSSPELASNVVYKI-----EPVDQHAK-ANCECYDAVIVSEVLEHVKDKVSLLEASV-RSLKPG 195
              |||:. .|...||     |..:.|.. |:.:...|..|.:.| |..|.|:|...:: |.||..
 Worm    77 --SSPDF-ENFNSKIDFLLGEVTNFHVDGASFDVATAFFVLQFL-HKNDDVALAIQNISRHLKSR 137

  Fly   196 GSIFITTLNKTIPSWFGGVLLSE 218
            |:.|     ..||:...||...|
 Worm   138 GTFF-----GLIPNGVPGVRAPE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq3NP_610092.2 UbiG 41..297 CDD:273910 46/153 (30%)
Methyltransf_11 100..200 CDD:285453 34/107 (32%)
prmt-6NP_500168.2 AdoMet_MTases 3..>66 CDD:388410 17/50 (34%)
Methyltransf_25 40..138 CDD:379312 33/104 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43464
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.