DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq3 and coq-3

DIOPT Version :9

Sequence 1:NP_610092.2 Gene:Coq3 / 35383 FlyBaseID:FBgn0032922 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001041045.1 Gene:coq-3 / 178403 WormBaseID:WBGene00000763 Length:268 Species:Caenorhabditis elegans


Alignment Length:306 Identity:95/306 - (31%)
Similarity:147/306 - (48%) Gaps:48/306 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RNALLVSGKLRHLLSCSIGRNSTRSSSTAKSLDAGTQKEVRHHENHASEWWNQNGTMGALHALNE 67
            |:|.::: ||:.|       :||.|:::..|:|.   |||....:.::||.::.|...|||:||.
 Worm     5 RSARIIA-KLQRL-------HSTTSAASVSSIDV---KEVEKFGDLSAEWADELGPFHALHSLNR 58

  Fly    68 IRVPFIRDGIVSRGTVKPGYVNTTKVLLGQNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEA 132
            ||||:|.|.:.......|           ..:::||.|||||:..|||.|..|.|||..::.:||
 Worm    59 IRVPWIVDNVRKSDQKAP-----------PRLVDVGSGGGLLSIPLARSGFDVTGIDATKQAVEA 112

  Fly   133 AREHLKCSSPELA---SNVVYKIEPVDQHAKA--NCECYDAVIVSEVLEHVKDKVSLLEASVRSL 192
            |.:.|.....::|   ..:.::...|:...:.  |...||||:.||::|||.|....:.......
 Worm   113 ANQSLTAKPLQIAGISKRLRFEHTSVEDFCQKPHNKSAYDAVVASEIVEHVADLPGFIGCLAELA 177

  Fly   193 KPGGSIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHHWDKMISPLDVQRILDTSKFISGFIFRL 257
            :||..:||||:|:|..|....:.|:|.||.:||.|.|.|:|.|:|.:                  
 Worm   178 RPGAPLFITTINRTWLSKLAAIWLAENVLKIVPPGVHDWEKFITPAE------------------ 224

  Fly   258 GYSLFSRSSAVNCQTVLVNGSTYDFWSNTWRWINNNQMCYALQAVK 303
               |.|......|:...|:|..:....|.|.||.:.|..|.:.|||
 Worm   225 ---LTSHLEKAGCRVTAVHGLMFHPVGNHWTWIESTQCNYGILAVK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq3NP_610092.2 UbiG 41..297 CDD:273910 80/260 (31%)
Methyltransf_11 100..200 CDD:285453 34/104 (33%)
coq-3NP_001041045.1 UbiG 32..262 CDD:273910 80/261 (31%)
Methyltransf_18 75..188 CDD:289607 38/123 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159634
Domainoid 1 1.000 61 1.000 Domainoid score I6996
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9683
Inparanoid 1 1.050 138 1.000 Inparanoid score I3115
Isobase 1 0.950 - 0 Normalized mean entropy S2416
OMA 1 1.010 - - QHG63170
OrthoDB 1 1.010 - - D1542938at2759
OrthoFinder 1 1.000 - - FOG0003214
OrthoInspector 1 1.000 - - oto20585
orthoMCL 1 0.900 - - OOG6_102172
Panther 1 1.100 - - LDO PTHR43464
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R233
SonicParanoid 1 1.000 - - X2172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.