DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq3 and coq3

DIOPT Version :9

Sequence 1:NP_610092.2 Gene:Coq3 / 35383 FlyBaseID:FBgn0032922 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001184017.1 Gene:coq3 / 100486084 XenbaseID:XB-GENE-985854 Length:346 Species:Xenopus tropicalis


Alignment Length:299 Identity:108/299 - (36%)
Similarity:167/299 - (55%) Gaps:37/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SCSIGRN------STRSSSTAKSLDAGTQKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRD 75
            ||:...|      :.|..:|::::|   ..|:|..:....:||::.|....|||:|:||||||||
 Frog    57 SCNENENRGNICHNFRMYATSQTVD---PLEMRKFQAWVQKWWDEEGMFSVLHAMNDIRVPFIRD 118

  Fly    76 GIVSRGTVKPGYVNTTKV-LLGQNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKC 139
            .::||     .|.:.... |.|.|||:||||||||:|.|.||||.|.|||..|..|:.|.:| |.
 Frog   119 SLMSR-----NYEHDVGCPLSGVNILDVGCGGGLLSEPLGRLGASVTGIDPLEDNIKIAAQH-KS 177

  Fly   140 SSPELASNVVYKIEPVDQHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLN 204
            ..|.|...|.||...|::....:...:||::.|||||||.|..|.:::..:.||||||:|:||:|
 Frog   178 FDPVLDKQVQYKSCTVEELVDGHLGYFDAIVASEVLEHVADVESFIQSCFQVLKPGGSLFVTTIN 242

  Fly   205 KTIPSWFGGVLLSEYVLNLVPRGTHHWDKMISPLDVQRILDTSKFISGFIFRLGYSLFSRSSAVN 269
            ||..|:...::::|.:|.:.|.|||.|:|.|.|.:::|:|:::.|:                   
 Frog   243 KTQLSYALAIVVAEKILGIAPEGTHDWEKFIHPEELERLLESNGFV------------------- 288

  Fly   270 CQTVLVNGSTYDFWSNTWRWINNNQMCYALQAVKQAQRE 308
              ...:.|..|:..|.:|.||::..:.||:.|:|...:|
 Frog   289 --VESLKGMLYNPLSGSWSWISDTSVNYAMHALKTVAQE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq3NP_610092.2 UbiG 41..297 CDD:273910 97/256 (38%)
Methyltransf_11 100..200 CDD:285453 47/99 (47%)
coq3NP_001184017.1 UbiG 84..314 CDD:273910 97/256 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7832
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9683
Inparanoid 1 1.050 185 1.000 Inparanoid score I3817
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1542938at2759
OrthoFinder 1 1.000 - - FOG0003214
OrthoInspector 1 1.000 - - oto103965
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R233
SonicParanoid 1 1.000 - - X2172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.