DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpp6 and Mphosph6

DIOPT Version :9

Sequence 1:NP_001286116.1 Gene:Mpp6 / 35382 FlyBaseID:FBgn0032921 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_081034.1 Gene:Mphosph6 / 68533 MGIID:1915783 Length:161 Species:Mus musculus


Alignment Length:173 Identity:59/173 - (34%)
Similarity:91/173 - (52%) Gaps:28/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSKSKPRLSRGVLDMKFMQRTKVKVEKEADDEQSRALYSNE---INQKMLNSTSNFVV-ESSYS 61
            |.|:.|.:||:.:|.||||||......|:..:|:.|.:.|:|   ::...|....:|:| |.|:|
Mouse     1 MASERKTKLSKNLLRMKFMQRGLDSETKKQLEEEERKMISDEHWYLDLPELKEKESFIVEEQSFS 65

  Fly    62 ICAGLIDGRLSFRGMNPELELLMEQDLAEKQGRTRPEQPKE-------VSDQDMVKAYYANKAPT 119
            :|..|:.||:||||.|||:|.||.|    ...:.|.|..:|       |||::|.:.|     .|
Mouse    66 LCEDLLYGRMSFRGFNPEVEKLMLQ----MNSKNRAEAAEEDETVEVDVSDEEMARRY-----ET 121

  Fly   120 VSGSMSKKFNTKKDFKRKQIGGDSDSPHAMK----KQYFKKPR 158
            :.|::.|||..|:|    :...:.|....:|    |:.|.||:
Mouse   122 LVGTIGKKFVKKRD----RANYEEDENGTIKAIKPKKMFLKPQ 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpp6NP_001286116.1 MPP6 8..133 CDD:287184 49/135 (36%)
Mphosph6NP_081034.1 MPP6 8..136 CDD:287184 50/140 (36%)
Nuclear localization signal. /evidence=ECO:0000255 117..134 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9375
eggNOG 1 0.900 - - E1_KOG4531
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5194
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50093
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004395
OrthoInspector 1 1.000 - - oto94462
orthoMCL 1 0.900 - - OOG6_105849
Panther 1 1.100 - - LDO PTHR13582
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5263
SonicParanoid 1 1.000 - - X4195
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.