DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpp6 and SPACUNK4.11c

DIOPT Version :9

Sequence 1:NP_001286116.1 Gene:Mpp6 / 35382 FlyBaseID:FBgn0032921 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_593967.1 Gene:SPACUNK4.11c / 2542214 PomBaseID:SPACUNK4.11c Length:188 Species:Schizosaccharomyces pombe


Alignment Length:183 Identity:50/183 - (27%)
Similarity:82/183 - (44%) Gaps:39/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSRGVLDMKFMQRTKVKVEKEADDEQSRALYSNE----------INQKMLNSTSNFVVESSYSIC 63
            :|..:|.||||||.:....|:|::|.|:.:.::|          :.|||   |.|...||.|   
pombe     1 MSSKLLSMKFMQRARGIDPKQAEEELSKNIVTDEHWSLAGKVDFLPQKM---TRNVEYESGY--- 59

  Fly    64 AGLID---------------GRLSFRGMNPEL--ELLMEQDLAEKQ----GRTRPEQPKEVSDQD 107
            .|||:               ||.||...|.||  |.:.|:|:::.:    ..|:.....|:::::
pombe    60 GGLIEENDLESHSNEPNLVQGRASFGLFNKELGEENVDEKDVSKNEEVDVNGTKITDTSELTERE 124

  Fly   108 MVKAYYANKAPTVSGSMSKKFNTKKDFKRK--QIGGDSDSPHAMKKQYFKKPR 158
            ..|....:|....|..|..|...|:..|||  ::..|..|.|:.|:...:|.:
pombe   125 RRKQELVSKKAEASRKMEVKAPAKESKKRKVNELSQDVISLHSPKESNARKTK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpp6NP_001286116.1 MPP6 8..133 CDD:287184 42/154 (27%)
SPACUNK4.11cNP_593967.1 MPP6 2..140 CDD:287184 39/143 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004395
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105849
Panther 1 1.100 - - LDO PTHR13582
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5263
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.990

Return to query results.
Submit another query.