DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpp6 and F29A7.6

DIOPT Version :9

Sequence 1:NP_001286116.1 Gene:Mpp6 / 35382 FlyBaseID:FBgn0032921 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_494349.1 Gene:F29A7.6 / 173618 WormBaseID:WBGene00017916 Length:189 Species:Caenorhabditis elegans


Alignment Length:183 Identity:50/183 - (27%)
Similarity:81/183 - (44%) Gaps:43/183 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSRGVLDMKFMQRTKVKVEKEADDEQSRALYSNEINQKMLNST-SNFVVESS---------YSIC 63
            ||..:||||||.:.|.::|.:| .::..|.....|.:|...:| |..:::||         |:..
 Worm    12 LSSSLLDMKFMLKKKKQIETKA-AKKKEAKLDQLITEKEAEATCSTEILKSSEPKLEICYDYAKL 75

  Fly    64 AGLIDGRLSFRGMNPELELLME--QDLAEKQGRTRPEQPKEVSDQDMVKAYYANKAPTVSGSMSK 126
            ..|..|||||.|.|.|:|||||  :.|.........:...:|.|::|.|:....|.    .::.|
 Worm    76 ENLKFGRLSFGGFNKEVELLMEYYEKLQNGMLSDSDDDGMDVDDEEMAKSLGGQKL----AALDK 136

  Fly   127 KFNTKKDFK--------------------RKQIGGD--SDSPHAMKKQYFKKP 157
            |..:|::.:                    ||:...|  :|:|    ::.|.||
 Worm   137 KSQSKRERRQQNERNEETTGGRRFNIKDIRKRFAADDVADAP----ERKFMKP 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpp6NP_001286116.1 MPP6 8..133 CDD:287184 42/135 (31%)
F29A7.6NP_494349.1 MPP6 11..144 CDD:287184 42/136 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4531
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1436304at2759
OrthoFinder 1 1.000 - - FOG0004395
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105849
Panther 1 1.100 - - LDO PTHR13582
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.