DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpp6 and MPHOSPH6

DIOPT Version :9

Sequence 1:NP_001286116.1 Gene:Mpp6 / 35382 FlyBaseID:FBgn0032921 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_005783.2 Gene:MPHOSPH6 / 10200 HGNCID:7214 Length:160 Species:Homo sapiens


Alignment Length:164 Identity:54/164 - (32%)
Similarity:88/164 - (53%) Gaps:11/164 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSKSKPRLSRGVLDMKFMQRTKVKVEKEADDEQSRALYSNE---INQKMLNSTSNFVV-ESSYS 61
            |.::.|.|||:.:|.||||||......|:..:|:.:.:.|.|   ::...|....:|:: |.|:.
Human     1 MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFL 65

  Fly    62 ICAGLIDGRLSFRGMNPELELLMEQDLAEKQGRTRPEQPKE--VSDQDMVKAYYANKAPTVSGSM 124
            :|..|:.||:||||.|||:|.||.|..|:.:.....::..|  |||::|.:.|     .|:.|::
Human    66 LCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRY-----ETLVGTI 125

  Fly   125 SKKFNTKKDFKRKQIGGDSDSPHAMKKQYFKKPR 158
            .|||..|:|....:...:.|......|:.|.||:
Human   126 GKKFARKRDHANYEEDENGDITPIKAKKMFLKPQ 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpp6NP_001286116.1 MPP6 8..133 CDD:287184 46/130 (35%)
MPHOSPH6NP_005783.2 MPP6 8..135 CDD:287184 46/131 (35%)
Nuclear localization signal. /evidence=ECO:0000255 116..133 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9599
eggNOG 1 0.900 - - E1_KOG4531
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5227
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50093
OrthoDB 1 1.010 - - D1436304at2759
OrthoFinder 1 1.000 - - FOG0004395
OrthoInspector 1 1.000 - - oto90881
orthoMCL 1 0.900 - - OOG6_105849
Panther 1 1.100 - - LDO PTHR13582
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5263
SonicParanoid 1 1.000 - - X4195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.