DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and ATE2F2

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_175222.1 Gene:ATE2F2 / 841202 AraportID:AT1G47870 Length:396 Species:Arabidopsis thaliana


Alignment Length:221 Identity:69/221 - (31%)
Similarity:104/221 - (47%) Gaps:39/221 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SLVLLTQKFVDLV-KANEGSIDLKAATKILDVQKRRIYDITNVLEGIGLIDK--GRHCSLVRWRG 138
            ||.|||:|||.|: :|.:|::||.....:|:|||||||||||||||||||:|  ..|   :||:|
plant   159 SLGLLTKKFVKLIQEAEDGTLDLNYCAVVLEVQKRRIYDITNVLEGIGLIEKTTKNH---IRWKG 220

  Fly   139 GGFNNAKD-QENYDLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLDIF 202
            ......|| .:.....:|....::..|..||..:...|..||.:.:|...|.|.::|.:|     
plant   221 ADNLGQKDLGDQISRLKSEVESMQSEESRLDDLIRERQEALRSLEEDDYCRRYMFMTEED----- 280

  Fly   203 GDDSVFTIPNYDEEVDIKRNHYELAVSLDNGSAIDI------------RLVTNQGKSTTNPHDVD 255
                :.::|.:       :|...||:.....|.|::            |:|.   :|...|.|| 
plant   281 ----ITSLPRF-------QNQTLLAIKAPTASYIEVPDPDEMSFPQQYRMVI---RSRMGPIDV- 330

  Fly   256 GFFDYHRLDTPSPSTSSHSSEDGNAP 281
            .....::.|:...|....:..|..||
plant   331 YLLSKYKGDSAETSDKLGNESDQKAP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 37/63 (59%)
E2F_DD 159..>218 CDD:304549 12/58 (21%)
ATE2F2NP_175222.1 E2F_TDP 157..220 CDD:280479 37/63 (59%)
E2F_DD 231..336 CDD:271137 24/124 (19%)
coiled coil 231..266 CDD:271137 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2215
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12081
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.930

Return to query results.
Submit another query.