DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and E2F1

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_568413.1 Gene:E2F1 / 832283 AraportID:AT5G22220 Length:469 Species:Arabidopsis thaliana


Alignment Length:402 Identity:107/402 - (26%)
Similarity:188/402 - (46%) Gaps:83/402 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRKT---ASIVKRDSSAAGTTSSAMMMKVDSAETSVRS-QSYESTPVSMDTSPDPPTPIKSPSNS 63
            ||||   ..||:.:....|...:.:..|...|:.:.|| :|.:|..::..::..      ||.|:
plant    63 KRKTDLVNQIVEVNELNTGVLQTPVSGKGGKAKKTSRSAKSNKSGTLASGSNAG------SPGNN 121

  Fly    64 QSQSQPGQQRSVGSLVLLTQKFVDLVK-ANEGSIDLKAATKILDVQKRRIYDITNVLEGIGLIDK 127
            .:|:  |..|...||.|||:||::|:| |.:|.:||..|...|:|||||||||||||||||||:|
plant   122 FAQA--GTCRYDSSLGLLTKKFINLIKQAEDGILDLNKAADTLEVQKRRIYDITNVLEGIGLIEK 184

  Fly   128 GRHCSLVRWRGGGFNNAKDQENYDLARSRTNHLKML---EDDLDRQLEYAQRNLRYVMQDPSNRS 189
            ... :.::|:  |.:.:|..|..:...:..:.::.|   |..||.|:..:|..|..:.:|.:|:.
plant   185 TLK-NRIQWK--GLDVSKPGETIESIANLQDEVQNLAAEEARLDDQIRESQERLTSLSEDENNKR 246

  Fly   190 YAYVTRDDLLDIFGDDSVFTIPNYDEEVDIKRNHYELAVSLDNGSAIDI-------------RLV 241
            ..:||.:|:.:         :|.:       :|...:||...:|:.:::             |::
plant   247 LLFVTENDIKN---------LPCF-------QNKTLIAVKAPHGTTLEVPDPDEAGGYQRRYRII 295

  Fly   242 TNQGKSTTNPHDV-------DGFFDYHRLDTPS--PSTSSHSSE-DGNAPACAGNVITDEHGYSC 296
            .   :||..|.||       :.|.|..:.|.||  |...|:..: ..|.|:.:|  :.:.|..|.
plant   296 L---RSTMGPIDVYLVSQFEESFEDIPQADEPSNVPDEPSNVPDVPSNLPSTSG--LPENHDVSM 355

  Fly   297 NPGMKDEMKLLENELTAKIIFQNYLSGHSLRRFYPDDPNLEN----PPLLQLNPPQEDF--NFAL 355
              .||:|.  .|..:..:.:       ...:|.|.|   :|:    ..::::.||..|.  ::..
plant   356 --PMKEES--TERNMETQEV-------DDTQRVYSD---IESHDFVDGIMKIVPPDLDMGVDYWF 406

  Fly   356 KSDEGICELFDV 367
            :|:.|...:.|:
plant   407 RSEVGEVSITDM 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 36/61 (59%)
E2F_DD 159..>218 CDD:304549 13/61 (21%)
E2F1NP_568413.1 E2F_TDP 131..194 CDD:396755 36/65 (55%)
E2F_DD 205..310 CDD:271137 23/123 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1472
Inparanoid 1 1.050 96 1.000 Inparanoid score I2215
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12081
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.