DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and E2F8

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001243300.1 Gene:E2F8 / 79733 HGNCID:24727 Length:867 Species:Homo sapiens


Alignment Length:170 Identity:45/170 - (26%)
Similarity:67/170 - (39%) Gaps:46/170 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KTASIVKRDSSAAGTTSSAMMMKVDSAETS---VRSQSYESTPVSMDTSPD----------PPTP 56
            ||...:|............||:|....|..   ::|.|.|...:..:|.|:          |...
Human   188 KTLGTLKSIGEENKYAEQIMMIKKKEYEQEFDFIKSYSIEDHIIKSNTGPNGHPDMCFVELPGVE 252

  Fly    57 IKSPS-NSQSQSQPGQQRSVGSLVLLTQKFVDLVKANEGSI-DLKAATKIL-------DVQK--- 109
            .::.| ||:...         ||.:::||||.|...:...| .|:.|.|||       |:.|   
Human   253 FRAASVNSRKDK---------SLRVMSQKFVMLFLVSTPQIVSLEVAAKILIGEDHVEDLDKSKF 308

  Fly   110 ----RRIYDITNVLEGIGLI-------DKGRHCSLVRWRG 138
                ||:|||.|||..:.||       ::||..:. :|.|
Human   309 KTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAF-KWTG 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 28/82 (34%)
E2F_DD 159..>218 CDD:304549
E2F8NP_001243300.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..58
E2F_TDP 114..182 CDD:308118
E2F_TDP 262..347 CDD:308118 28/94 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..432
Atrophin-1 <464..700 CDD:331285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..616
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 771..800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.