DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and e2f3

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001074097.2 Gene:e2f3 / 791146 ZFINID:ZDB-GENE-070112-882 Length:429 Species:Danio rerio


Alignment Length:368 Identity:103/368 - (27%)
Similarity:160/368 - (43%) Gaps:78/368 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ETSVRSQSYESTPVSMDTSPDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLV-KANEGS 95
            |..:....| |.|.....|......:|.|  ...::.|.:.|...||..||:||..|: ::::|.
Zfish    92 ELDITDHQY-SEPAKTLRSRKGALKLKIP--KAPKTPPEKTRYDTSLGFLTKKFCQLLAQSSDGV 153

  Fly    96 IDLKAATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWRG------GGFNNAKDQENYDLAR 154
            :||..|..:|:|||||:|||||||||:.||.| :..:.::|.|      ||..:.. .:::.|||
Zfish   154 LDLNKAAIVLNVQKRRLYDITNVLEGVRLIKK-KSKNNIQWLGSSLPSDGGLPSPA-MQSHSLAR 216

  Fly   155 SRTNHLKMLEDD--LDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLDI--FGDDSVFTIPNYDE 215
            ..   |.:.:::  ||..::...||::.:.::..::.|||||..|:..|  ..|.:|..|....|
Zfish   217 EM---LALTQEERRLDELIQTCTRNVQQMTEEIHSQKYAYVTYQDIRRIKSLKDQTVIAIKAPSE 278

  Fly   216 ---EVDIKRNHYELAVSLDNGSAIDIRLVTNQGKSTTNPHDVDGFFDYHRLDTPSPSTSSHSSED 277
               ||...:...::.:|...| .||:.|.|:.|                  |:.|| ..:....:
Zfish   279 TKLEVPDPKESLQVHLSSSKG-PIDVFLCTDGG------------------DSGSP-LQNGLDVN 323

  Fly   278 GNAPACAGNVITDEHGYSCNPGMKDEMKLLENELTAKIIFQNYLSGHSLRRFYPDDPNLENPPLL 342
            ||.||..  .::.|   :.:.|..|.:|:..|            |..|:..|.|...|....||.
Zfish   324 GNHPAFL--KVSQE---AASDGPADNVKMNGN------------SNASVNGFGPVSGNAPMSPLS 371

  Fly   343 Q-----LNPPQEDFNF-----ALKSDE---------GICELFD 366
            .     |..|:|...|     ||.|||         ||.:|||
Zfish   372 SSLSSILQQPEEAIPFVPLSPALLSDEYMLGLGDEQGISDLFD 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 30/61 (49%)
E2F_DD 159..>218 CDD:304549 17/65 (26%)
e2f3NP_001074097.2 E2F_TDP 132..195 CDD:280479 30/63 (48%)
E2F_DD 213..306 CDD:271137 25/96 (26%)
coiled coil 213..244 CDD:271137 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3254
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.