DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and e2f2

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_003200395.2 Gene:e2f2 / 568846 ZFINID:ZDB-GENE-030131-704 Length:438 Species:Danio rerio


Alignment Length:423 Identity:102/423 - (24%)
Similarity:177/423 - (41%) Gaps:77/423 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRKTASIVKRDSSAAGTTSSAMMMKVDSAETSV-RSQSYESTPVSMDTSPDPPTP---------- 56
            ::|..:.::.|....|..|..|........|.: .:.:.|..|..:..:|..|.|          
Zfish    24 QKKMFTAMRTDFFTTGLASPPMNSVPAGYFTQIGNTTAVEQRPNCLYATPHGPEPKPVRTSSGRL 88

  Fly    57 ----------------IKSP-----------SNSQSQSQPGQQ-RSVGSLVLLTQKFVDLV-KAN 92
                            .::|           |:.::...||:: |...||.|||:|||.|: ::.
Zfish    89 PAKRRLDLEEPLYLPEFRTPKGKGNAACARASSPKTPKSPGERTRYDTSLGLLTKKFVGLLSESA 153

  Fly    93 EGSIDLKAATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWRGGGF--NNAKDQENYDLARS 155
            :|.:||..|:::|:|||||||||||||||:.||.| :..:.::|...|.  .::.:.|.......
Zfish   154 DGVLDLNWASEVLEVQKRRIYDITNVLEGVQLIRK-KSKNNIQWLISGVFEGSSSNSEKASALNK 217

  Fly   156 RTNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLDI--FGDDSVFTIPNYDE--- 215
            ..:.|...|..||..::.:...||.:.:...|:...|||..|:..|  ..|.:|..:....|   
Zfish   218 ELSELDRQEKALDDLIQSSSTRLREMTESKDNQRLGYVTYQDIRTITSLKDQTVIAVKAPSETKL 282

  Fly   216 EV-DIKRNHYELAVSLDNGSAIDIRLVTNQGKSTTNP-HDVDGFFDYHRLDTPSPSTSS------ 272
            || :......::.:...|| .|::.|...:....|:| .:.....||.:  |||.:|.|      
Zfish   283 EVPEASEGSLQIYLKSKNG-PIEVYLCPEECLEYTSPIKNATPRKDYPQ--TPSATTPSVFPPAK 344

  Fly   273 HSSEDG--NAPACAGNVITDEHGYSCNPGMKDEMKLLENELTAKIIFQNYLSGHSLRRFYPDDPN 335
            ..|.:|  ..|:.|.:.       |.|..:.|...:|:...:...|.::.|.|.:    :..|| 
Zfish   345 PQSVEGPKTQPSMAAST-------SGNGSLLDVEGILDLPPSLLQITEDQLPGMA----FASDP- 397

  Fly   336 LENPPLLQLNPP--QEDFNFALKSDEGICELFD 366
              :.|.:..:|.  .:|:.:.|...||:.:.||
Zfish   398 --SGPFVSFSPQLGHDDYLWGLDDGEGVSDFFD 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 33/61 (54%)
E2F_DD 159..>218 CDD:304549 17/64 (27%)
e2f2XP_003200395.2 E2F_TDP 135..197 CDD:280479 32/62 (52%)
E2F_DD 210..311 CDD:271137 22/101 (22%)
coiled coil 210..245 CDD:271137 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.