DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and e2f6

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_005160782.1 Gene:e2f6 / 560495 ZFINID:ZDB-GENE-030131-513 Length:406 Species:Danio rerio


Alignment Length:270 Identity:70/270 - (25%)
Similarity:122/270 - (45%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VKRDSSAAGTTSSAMMMKVDSAETSVRSQSYESTPVSMDTSPDPPTPIKSPSNSQSQSQPGQQRS 74
            :..|:::..|.|...       |.|| :||:.  |:.  :||....|:....:..:...|  .||
Zfish   133 IPADNNSNSTISKPQ-------EQSV-TQSFR--PIF--SSPTILPPVNVADDVFNSKAP--HRS 183

  Fly    75 VGSLVLLTQKFVDLVK-ANEGSIDLKAATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWRG 138
            ..:|..||::|:.|:. |.||.:||...::.|..:|||:||||:||.||.|:.|... :.::|..
Zfish   184 EVALGQLTKRFMQLLNAAPEGVLDLNEVSRKLGARKRRVYDITSVLAGIHLLKKTSK-NKIQWMS 247

  Fly   139 GGFNNAKDQENYDLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDL--LDI 201
            ....::...:....|::...|||..|:.||..::...:.|..:.....|...||||.:|:  :|:
Zfish   248 STPLSSFGSQWSPKAKAELLHLKSTEEALDWLIKDCAQQLFALTDLKDNADSAYVTYEDICQIDV 312

  Fly   202 FGDDSVFTIPNYDEEVDIKRNHYELAVSLDNGSAIDIRLVTNQGKSTTNPHDVDGFFDYHRLDTP 266
            |.|.::..|...:|.        :|.|......:|.|.|..::|...|...:.:|         |
Zfish   313 FKDQTIIAIRAPEET--------KLEVPTPTEESIKIHLKGSRGPIHTLTCETEG---------P 360

  Fly   267 SPSTSSHSSE 276
            ..:..|.::|
Zfish   361 GDAEDSSNTE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 25/61 (41%)
E2F_DD 159..>218 CDD:304549 18/60 (30%)
e2f6XP_005160782.1 THAP 3..79 CDD:283206
E2F_TDP 187..246 CDD:280479 24/59 (41%)
E2F_DD 263..358 CDD:271137 25/102 (25%)
coiled coil 263..292 CDD:271137 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.