DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and e2f3

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001011109.1 Gene:e2f3 / 496522 XenbaseID:XB-GENE-974737 Length:427 Species:Xenopus tropicalis


Alignment Length:334 Identity:98/334 - (29%)
Similarity:154/334 - (46%) Gaps:66/334 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLV-KANEGSIDLKAATKILDVQKRRIYD 114
            ||.|...|||..        :.|...||.|||:||:.|: ::::|.:||..|.::|.||||||||
 Frog   126 PDSPKTPKSPLE--------KTRYDTSLGLLTKKFIQLLSQSSDGVVDLNRAAEVLKVQKRRIYD 182

  Fly   115 ITNVLEGIGLIDKGRHCSLVRWRG-----GGFNNAKDQENYDLARSRTNHLKMLEDDLDRQLEYA 174
            ||||||||.||.| :..:.::|.|     .|.|.||.||    .....:.|...|:.||..::..
 Frog   183 ITNVLEGIHLIKK-KSKNNIQWMGCTLPDDGGNLAKSQE----LSKELSELAQEENKLDELIKNC 242

  Fly   175 QRNLRYVMQDPSNRSYAYVTRDDLLDIFG--DDSVFTI---PNYDEEVDIKRNHYELAVSLDNGS 234
            ..:|:::.::..|:..||||..|:..|.|  :.:|..|   |....||.......::.:|...| 
 Frog   243 TLDLKHLTENAENQRLAYVTYQDIRKISGLKEQTVIVIRAPPETRLEVPDPVESLQIHLSSSQG- 306

  Fly   235 AIDIRLVTNQGKSTTNP-----HDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEHGY 294
            ||::.|...:.:| ::|     .|.:|     .:..|.|     .|:|..:|... ||.....|.
 Frog   307 AIEVYLCPEESES-SSPVKQCNQDHNG-----NVSKPKP-----HSKDSLSPNME-NVNCSVEGI 359

  Fly   295 SCNPGMKDEMKLLENELTAKIIFQNYLSGHSLRRFYPDDPNLENPPLLQLNPP--QEDFNFALKS 357
            |......:.::..|::::..:                      :.|.:.|.||  |||:..:|..
 Frog   360 SPLTSPTNLLQQTEDQISLNM----------------------DAPFVNLLPPLMQEDYLLSLGD 402

  Fly   358 DEGICELFD 366
            :|||.:|||
 Frog   403 EEGISDLFD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 33/61 (54%)
E2F_DD 159..>218 CDD:304549 17/63 (27%)
e2f3NP_001011109.1 E2F_TDP 141..205 CDD:367033 33/64 (52%)
E2F_DD 216..316 CDD:271137 27/104 (26%)
coiled coil 216..251 CDD:271137 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3254
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.