DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and e2f5

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001184229.1 Gene:e2f5 / 402908 ZFINID:ZDB-GENE-030828-3 Length:363 Species:Danio rerio


Alignment Length:364 Identity:114/364 - (31%)
Similarity:176/364 - (48%) Gaps:64/364 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SNSQS--QSQP-GQQRSVGSLVLLTQKFVDLV-KANEGSIDLKAATKILDV-QKRRIYDITNVLE 120
            |||.|  .|.| |..|...||.|||.|||.|: :|.:|.:|||.|...|.| |||||||||||||
Zfish     4 SNSASFPHSTPNGSSRHEKSLGLLTVKFVTLLQEAKDGVLDLKVAADSLAVKQKRRIYDITNVLE 68

  Fly   121 GIGLIDKGRHCSLVRWRG--GGFNNAKDQENYDLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQ 183
            |||||:| :..:.::|:|  .|....:..|..:|.::....|::.|.:||.|....|::::.:.:
Zfish    69 GIGLIEK-KTKNTIQWKGESTGCQPQEVLEQVELLKANIADLELQERELDMQKACLQQSIKQLNE 132

  Fly   184 DPSNRSYAYVTRDDLLDIFGDDSVFTI--PNYDE-EVDIK------RNHYELAVSLDNGSA-IDI 238
            ||.:..|:||..:|:.|.|..|::..:  |:..: ||.:.      :..|:  |:|.:.|| |.:
Zfish   133 DPYSCRYSYVMHEDICDAFSGDTLLAVMAPSGTQLEVPVPEMGHNGQKKYQ--VNLRSHSAPIQV 195

  Fly   239 RLVTNQGKSTTNP--HDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEHG-------- 293
            .|: |:..|.:.|  ..|....|...:.|| |||.:...   ..|..:.::...:||        
Zfish   196 MLI-NRETSCSKPVVVSVPPIDDISSMPTP-PSTPAGLQ---RFPISSIDLCDQKHGLLKSPAAE 255

  Fly   294 -------------YSCNP-GMKDEMKLLENELTAKIIFQNYLSGHSLRRFYPD------------ 332
                         ..||| ....:..|:::.|......|..|.|..|:....:            
Zfish   256 HQLTPSSTSPDVHMECNPESPASQCLLMQSSLGGPEEQQRELGGQDLQSMLEEMRDEREGVSNLI 320

  Fly   333 DPNLENP--PLLQLNP-PQEDFNFALKSDEGICELFDVQ 368
            |..:.:.  |||:|:| |..|::|.|..:||:|:|||||
Zfish   321 DELMSSDVFPLLRLSPNPGVDYSFNLDDNEGVCDLFDVQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 37/62 (60%)
E2F_DD 159..>218 CDD:304549 17/61 (28%)
e2f5NP_001184229.1 E2F_TDP 21..85 CDD:280479 37/64 (58%)
COG5665 74..>328 CDD:227952 54/261 (21%)
E2F_DD 97..201 CDD:271137 28/106 (26%)
coiled coil 97..132 CDD:271137 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1472
Inparanoid 1 1.050 125 1.000 Inparanoid score I4681
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12081
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3254
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.