DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and E2f7

DIOPT Version :10

Sequence 1:NP_477355.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001101562.2 Gene:E2f7 / 314818 RGDID:1310258 Length:902 Species:Rattus norvegicus


Alignment Length:136 Identity:44/136 - (32%)
Similarity:61/136 - (44%) Gaps:23/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DTSPDP-PTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLVKANEGSI-DLKAATKIL----- 105
            |.|||| ...:...|.|...|.....|...||.:::||||.|...::..| .|..|.|||     
  Rat   257 DGSPDPRDQHLLDFSESDYPSSSANSRKDKSLRIMSQKFVMLFLVSKTKIVTLDVAAKILIEESQ 321

  Fly   106 ---DVQK-----RRIYDITNVLEGIGLI-------DKGRHCSLVRWRGGGFNNAKDQENYDLARS 155
               |..|     ||:|||.|||..:.||       ::||..:. :|.|....::.|:|..|::.|
  Rat   322 DTPDHSKFKTKVRRLYDIANVLTSLALIKKVHVTEERGRKPAF-KWIGPVDFSSIDEELLDVSAS 385

  Fly   156 RTNHLK 161
            ....||
  Rat   386 VLPELK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_477355.1 E2F_TDP 77..138 CDD:460530 28/81 (35%)
E2F_DD 159..>218 CDD:473951 2/3 (67%)
E2f7NP_001101562.2 E2F_TDP 144..212 CDD:460530
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..283 8/25 (32%)
E2F_TDP 284..368 CDD:460530 28/84 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..439
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 589..627
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 665..690
Atrophin-1 684..>881 CDD:460830
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 844..902
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.