DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and E2f8

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001094050.2 Gene:E2f8 / 308607 RGDID:1308091 Length:877 Species:Rattus norvegicus


Alignment Length:504 Identity:100/504 - (19%)
Similarity:152/504 - (30%) Gaps:197/504 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KTASIVKRDSSAAGTTSSAMMMKVDSAETS---VRSQSYESTPVSMDTSPDPPTPIKSPSNSQSQ 66
            ||...:|............||:|....|..   ::|...|...:..|      ..|||.:.....
  Rat   188 KTLGTLKSVGEENKYAEQIMMIKRKEHEQEFDFIKSCGLEDHVIKGD------HVIKSTAGQNGH 246

  Fly    67 SQ------PG--------QQRSVGSLVLLTQKFVDLVKANEGSI-DLKAATKIL-------DVQK 109
            |.      ||        ..|...||.:::||||.|...:...| .|:.|.|||       |:.|
  Rat   247 SDMCFVELPGVEFRAASANSRKDKSLRVMSQKFVMLFLVSTPQIVSLEIAAKILIGEDHVEDLDK 311

  Fly   110 -------RRIYDITNVLEGIGLI-------DKGRHCSLVRWRGGGF--NN--------------- 143
                   ||:|||.|||..:.||       ::||..:. :|.|...  ||               
  Rat   312 SKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAF-KWTGPEISPNNSGSSPVMPLTASLEA 375

  Fly   144 ---AKDQENYDLARSR-----TNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLD 200
               ||:....:|..:|     |.|..:::  |.:.:|..:|.:......|...|.|..:::..  
  Rat   376 EQSAKENCAKNLFSTRGKPSFTRHPSLIK--LVKSIENDRRKISSAPSSPVKSSKAESSQNSP-- 436

  Fly   201 IFGDDSVFTIPN------------YDEE---------VDIKRN-HYELAVSLD------------ 231
                    .:||            .:|:         |::.|: ||:....||            
  Rat   437 --------PVPNKMAQLAAICKMQLEEQSSEPRKRVKVNLTRSGHYKPLAPLDPAVNTELELLAP 493

  Fly   232 ----------------------------NGSAIDIRLVTNQGKSTTNPHDVDGFFDYHRLDTPSP 268
                                        :|.:..|.|...|.:..|.||.:.        .|..|
  Rat   494 SLIQPLGMVPLIPSPLSSAVPVILPQAPSGPSYAIYLQPAQAQMLTPPHGLS--------PTVCP 550

  Fly   269 STSSH---SSEDGNAPACAGNVITDEHGYSCNPGM------------------------------ 300
            :.||:   |.:..:||.........:...||.||.                              
  Rat   551 TQSSNATGSKDPTDAPTEKTATDATKSSASCRPGSLQPAPERQGAKNRSKETTGDRGTKRTGALE 615

  Fly   301 ----------KDEMKLLENELTAKIIF-QNYLSGHSLRRFYPDDPNLEN 338
                      |:::|.|||..|...:| ..||...:.......||.|.|
  Rat   616 DGGPGPIKKPKEDLKALENVPTPTTLFPSGYLIPLTQCPSLGPDPMLSN 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 28/82 (34%)
E2F_DD 159..>218 CDD:304549 10/79 (13%)
E2f8NP_001094050.2 E2F_TDP 115..182 CDD:396755
E2F_TDP 269..353 CDD:396755 28/84 (33%)
PHA03247 <503..847 CDD:223021 31/170 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.