DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and E2f3

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001131098.2 Gene:E2f3 / 291105 RGDID:1561600 Length:458 Species:Rattus norvegicus


Alignment Length:355 Identity:105/355 - (29%)
Similarity:148/355 - (41%) Gaps:106/355 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SPDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLV-KANEGSIDLKAATKILDVQKRRIY 113
            |||.|...||||.        :.|...||.|||:||:.|: ::.:|.:||..|.::|.|||||||
  Rat   156 SPDSPKTPKSPSE--------KTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIY 212

  Fly   114 DITNVLEGIGLIDKGRHCSLVRWRG------GGFNNAKDQENYDLAR-----SRTNHLKMLEDDL 167
            |||||||||.||.| :..:.|:|.|      ||.          ||:     .....|...|..|
  Rat   213 DITNVLEGIHLIKK-KSKNNVQWMGCSLSEDGGM----------LAQCQGLSKEVTELSQEEKKL 266

  Fly   168 DRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLDIFG--DDSVFTI---PNYDEEVDIKRNHYELA 227
            |..::....:|:.:.:|..|:..||||..|:..|.|  |.:|..:   |....||.         
  Rat   267 DELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVP--------- 322

  Fly   228 VSLDNGSAIDIRLVTNQGKSTTNPHDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEH 292
               |:..::.|.|.:.||       .::.:......:|..|..:::...:||.|           
  Rat   323 ---DSIESLQIHLASTQG-------PIEVYLCPEETETHRPMKTNNQDHNGNIP----------- 366

  Fly   293 GYSCNPGMKDEMKLLENELTAKIIFQNYLSGHS------------------LRRFYPDDP-NLEN 338
                .|..||   |..|.           ||||                  |::.....| |||.
  Rat   367 ----KPTSKD---LASNN-----------SGHSDCSVSTANLSPLASPANLLQQTEDQIPSNLEG 413

  Fly   339 PPLLQLNPP--QEDFNFALKSDEGICELFD 366
             |.:.|.||  |||:..:|..:|||.:|||
  Rat   414 -PFVNLLPPLLQEDYLLSLGEEEGISDLFD 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 34/61 (56%)
E2F_DD 159..>218 CDD:304549 18/63 (29%)
E2f3NP_001131098.2 E2F_TDP 173..236 CDD:396755 34/63 (54%)
E2F_DD 247..347 CDD:271137 25/118 (21%)
coiled coil 247..282 CDD:271137 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.