powered by:
Protein Alignment E2f2 and F46B6.10
DIOPT Version :9
Sequence 1: | NP_001286115.1 |
Gene: | E2f2 / 35381 |
FlyBaseID: | FBgn0024371 |
Length: | 370 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505529.1 |
Gene: | F46B6.10 / 185841 |
WormBaseID: | WBGene00009775 |
Length: | 127 |
Species: | Caenorhabditis elegans |
Alignment Length: | 41 |
Identity: | 10/41 - (24%) |
Similarity: | 14/41 - (34%) |
Gaps: | 5/41 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 246 KSTTNPHDVDGFFD-----YHRLDTPSPSTSSHSSEDGNAP 281
||:..|...|..|. ..:.|.|..:..|...:|...|
Worm 72 KSSKEPDSTDDAFKEMAKRLAKKDKPEKTGDSIVGDDDENP 112
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
E2f2 | NP_001286115.1 |
E2F_TDP |
77..138 |
CDD:280479 |
|
E2F_DD |
159..>218 |
CDD:304549 |
|
F46B6.10 | NP_505529.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2577 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.