DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and E2f3

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_011242577.1 Gene:E2f3 / 13557 MGIID:1096340 Length:467 Species:Mus musculus


Alignment Length:355 Identity:105/355 - (29%)
Similarity:148/355 - (41%) Gaps:106/355 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SPDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLV-KANEGSIDLKAATKILDVQKRRIY 113
            |||.|...||||.        :.|...||.|||:||:.|: ::.:|.:||..|.::|.|||||||
Mouse   165 SPDSPKTPKSPSE--------KTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIY 221

  Fly   114 DITNVLEGIGLIDKGRHCSLVRWRG------GGFNNAKDQENYDLAR-----SRTNHLKMLEDDL 167
            |||||||||.||.| :..:.|:|.|      ||.          ||:     .....|...|..|
Mouse   222 DITNVLEGIHLIKK-KSKNNVQWMGCSLSEDGGM----------LAQCQGLSKEVTELSQEEKKL 275

  Fly   168 DRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLDIFG--DDSVFTI---PNYDEEVDIKRNHYELA 227
            |..::....:|:.:.:|..|:..||||..|:..|.|  |.:|..:   |....||.         
Mouse   276 DELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVP--------- 331

  Fly   228 VSLDNGSAIDIRLVTNQGKSTTNPHDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEH 292
               |:..::.|.|.:.||       .::.:......:|..|..:::...:||.|           
Mouse   332 ---DSIESLQIHLASTQG-------PIEVYLCPEETETHRPMKTNNQDHNGNIP----------- 375

  Fly   293 GYSCNPGMKDEMKLLENELTAKIIFQNYLSGHS------------------LRRFYPDDP-NLEN 338
                .|..||   |..|.           ||||                  |::.....| |||.
Mouse   376 ----KPTSKD---LASNN-----------SGHSDCSVSTANLSPLASPANLLQQTEDQIPSNLEG 422

  Fly   339 PPLLQLNPP--QEDFNFALKSDEGICELFD 366
             |.:.|.||  |||:..:|..:|||.:|||
Mouse   423 -PFVNLLPPLLQEDYLLSLGEEEGISDLFD 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 34/61 (56%)
E2F_DD 159..>218 CDD:304549 18/63 (29%)
E2f3XP_011242577.1 E2F_TDP 181..245 CDD:367033 34/64 (53%)
E2F_DD 256..356 CDD:271137 25/118 (21%)
coiled coil 256..291 CDD:271137 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3254
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.