DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and e2f6

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_002942229.1 Gene:e2f6 / 100494302 XenbaseID:XB-GENE-482439 Length:257 Species:Xenopus tropicalis


Alignment Length:204 Identity:73/204 - (35%)
Similarity:103/204 - (50%) Gaps:24/204 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLVK-ANEGSIDLKAATKILDVQKRRIYDITNVLE 120
            ||.|: .:|...|..:..| ||..||:||||::| |.||.:||......|.|:|||:|||||||:
 Frog    38 IKIPT-KKSLKLPRPRFDV-SLFYLTRKFVDIIKAAPEGVVDLNDVANTLGVRKRRVYDITNVLD 100

  Fly   121 GIGLIDKGRHCSLVRWRGGGFNNA--KDQENYDLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQ 183
            ||.||.| |..:.|:|.|...|::  |..|...| |:..:.|..:|:.||..::.....|..:.:
 Frog   101 GINLIQK-RSKNHVQWMGSDLNHSGTKIPEEQKL-RNDISDLTAMEEALDDLIKDCAHQLFKLTE 163

  Fly   184 DPSNRSYAYVTRDDLLDIFGDDSVFTIPNYDEEVDI---KRNHYELAVSLDNGSAIDIRLVTNQG 245
            |.:||..||||..|         :.:|..|.|::.|   .....:|.|.......|:|.:     
 Frog   164 DRANRKMAYVTYQD---------IHSIEEYHEQIVIAVKSPEETKLEVPAPKEDCIEIHI----- 214

  Fly   246 KSTTNPHDV 254
            |||..|.||
 Frog   215 KSTKGPIDV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 34/61 (56%)
E2F_DD 159..>218 CDD:304549 16/58 (28%)
e2f6XP_002942229.1 E2F_TDP 53..117 CDD:367033 35/65 (54%)
E2F_DD 129..229 CDD:271137 30/110 (27%)
coiled coil 129..163 CDD:271137 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.