DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and e2f1

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_012808274.2 Gene:e2f1 / 100493924 XenbaseID:XB-GENE-481741 Length:428 Species:Xenopus tropicalis


Alignment Length:374 Identity:103/374 - (27%)
Similarity:164/374 - (43%) Gaps:69/374 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KVDSAETSVRSQSYESTPVSMDTSPDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLV-K 90
            |:|....|..:|....||  ......|...:|||..        :.|...||.|.|::|::|: :
 Frog    83 KLDLETVSRYNQEALQTP--RGKGKRPLKAVKSPGE--------RSRYDTSLHLTTKRFLELLSQ 137

  Fly    91 ANEGSIDLKAATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWRGGGFNNAKDQENYDLARS 155
            :::|.:||..|.::|:||||||||||||||||.||.| :..:.::|. |..:.|:....|..|..
 Frog   138 SSDGVVDLNWAAQVLNVQKRRIYDITNVLEGIHLITK-KSKNHIQWL-GYTSYAEYNSRYQSALK 200

  Fly   156 RTNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLDIFGDDS--VFTIPNYDEEVD 218
            ....|:..|..||:.:..|...|: :.::....::.|||..||..| .|.|  :..:..|..:.|
 Frog   201 DCQKLEDQEKQLDKLIHMANTQLK-LFKEEECHNFGYVTCQDLRSI-ADPSERMLMVIRYPPDTD 263

  Fly   219 IKRNHYELAVSLDNGSAIDIRLVTNQGKSTTNPHDVDGFF---DYHRLDTP--SPSTSSHSSEDG 278
                   :.|| |...|..:.|     |||..|.||  |.   |...:.:|  ||:.:|.:....
 Frog   264 -------MCVS-DPAEAFQMSL-----KSTQAPIDV--FLCPDDSSGVCSPVTSPTKTSQAEPSS 313

  Fly   279 -NAPACAGNVITDEHGYSCNPGMKDEMKLL----------ENE-----------LTAKIIFQNYL 321
             |......:|...|...:..|.:...:.||          |||           |:...:..:|.
 Frog   314 INQAEPLPSVQPKEESPASIPMLDIGLGLLSDMQEPFLPPENEIPLDSTLNCLPLSPSNLLLDYR 378

  Fly   322 SGHSLRRFYPDDPNLENPPLLQLNP-PQEDFNFALKSDEGICELFDVQC 369
            .  ::..|.|:|       .:.|:| ..::::|.|::.||..|||:..|
 Frog   379 D--AMPDFLPND-------FISLSPASSQEYSFGLQTCEGAAELFNFDC 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 31/61 (51%)
E2F_DD 159..>218 CDD:304549 15/60 (25%)
e2f1XP_012808274.2 E2F_TDP 121..184 CDD:396755 31/64 (48%)
E2F_DD 193..292 CDD:271137 30/115 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.