DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f2 and e2f5

DIOPT Version :9

Sequence 1:NP_001286115.1 Gene:E2f2 / 35381 FlyBaseID:FBgn0024371 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001120880.1 Gene:e2f5 / 100151699 XenbaseID:XB-GENE-481326 Length:371 Species:Xenopus tropicalis


Alignment Length:392 Identity:105/392 - (26%)
Similarity:171/392 - (43%) Gaps:111/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PSNSQSQSQPGQQRSVGSLVLLTQKFVDLV-KANEGSIDLKAATKILDV-QKRRIYDITNVLEGI 122
            |:.:.|:    .::|:|   |||.|||.|: :|.:|.:|||.|...|.| |||||||||||||||
 Frog     4 PAGASSR----HEKSLG---LLTSKFVSLLQEAKDGVLDLKVAADSLAVRQKRRIYDITNVLEGI 61

  Fly   123 GLIDKGRHCSLVRWR--GGGFNNAKDQENYDLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQDP 185
            |||:| :..:.::|.  |.|.|..:..:.....::....|::.|.:||:|..:.|::::.||...
 Frog    62 GLIEK-KSKNSIQWNGVGAGCNTKEVLDRLRNLKAEIEDLELKEKELDQQKAWLQQSIKNVMDSS 125

  Fly   186 SNRSYAYVTRDDLLDIFGDDSVFTI--PNYDE-EVDIK------RNHYELAVSLDNGSAIDIRLV 241
            ||..|::||.:||.:.|..|::..|  |:..: ||.|.      :..|::::. .|...|.:.|:
 Frog   126 SNGMYSFVTHEDLCNCFNGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQISLK-SNSGPIQVLLI 189

  Fly   242 TNQGKST------TNPHDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEHGYSCNPGM 300
            ..:..|:      ..|.|          |...|::...::...|....|         .|.:..:
 Frog   190 NKESSSSKPVVFPVPPPD----------DLTQPNSQPEATASSNKQPAA---------QSSSLSV 235

  Fly   301 KDEMK--------------------LLEN------ELTAKIIF--------QNYLSGHSLRRFYP 331
            |:|.:                    |.||      ||...|::        |:..:........|
 Frog   236 KEEQESNLTEQAAAGKLNPECPASDLQENTSSSYPELPESILYSALGTDVAQSSAASSDYSPLLP 300

  Fly   332 DDPN-LENP-----------------------------PLLQLNPPQEDFNFALKSDEGICELFD 366
            .|.| :..|                             |||:|:|..:|::|.|..:||:|:|||
 Frog   301 LDVNSILRPNAFDITKMDEQEGQISGDLIDELMSSDVFPLLRLSPTPDDYSFNLDDNEGVCDLFD 365

  Fly   367 VQ 368
            ||
 Frog   366 VQ 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f2NP_001286115.1 E2F_TDP 77..138 CDD:280479 35/64 (55%)
E2F_DD 159..>218 CDD:304549 20/61 (33%)
e2f5NP_001120880.1 E2F_TDP 12..76 CDD:280479 37/67 (55%)
E2F_DD 88..192 CDD:271137 26/104 (25%)
coiled coil 88..123 CDD:271137 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1472
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087250at2759
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12081
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.