DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and GRAP2

DIOPT Version :9

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_001278753.1 Gene:GRAP2 / 9402 HGNCID:4563 Length:330 Species:Homo sapiens


Alignment Length:370 Identity:73/370 - (19%)
Similarity:119/370 - (32%) Gaps:119/370 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   781 IAAYPYESAEEGDLSFSAGEMVMVIKKEGEWWTGTIGSRTGMFPSNYV----------------- 828
            :|.:.:.::.|.:|||..|:::.::..:.||:...:||:.|..|.|::                 
Human     4 VAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQA 68

  Fly   829 ----QKADVG--------------TASTAAAEPVESLDQETTLNGN---------------AAYT 860
                ...:||              :.|....:.|:.........||               ..|.
Human    69 ENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYR 133

  Fly   861 AAPVEAQEQVYQPLPVQEPSEQ------------PISSPGVGAEEAHEDLDTEVS---------- 903
            ...:..|:|::.....:|....            |..|..|| ||....::.::|          
Human   134 TNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVG-EEIRPSMNRKLSDHPPTLPLQQ 197

  Fly   904 -QINTQSKTQSSEPAESYSRPMSRTSSMTPGMRAKRSEIAQVIAPYEATSTEQLSLTRGQLIMIR 967
             |...|....:..|.:....|..|........:.:|.....:...:..|.   |.......:|.|
Human   198 HQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTG---LGSEMNAALMHR 259

  Fly   968 KKTDSGWWEGELQAKGRRRQIGWFPATYVKVLQGGRNSGRNTPVSGSRIEMTEQILDKVIALYPY 1032
            :.||    ..:|||.||.|   |                                   ..|||.:
Human   260 RHTD----PVQLQAAGRVR---W-----------------------------------ARALYDF 282

  Fly  1033 KAQNDDELSFDKDDIISVLGRDEPEWWRGELNGLSGLFPSNYVGP 1077
            :|..||||.|...:::.||....|.||.|.|:...||||:|||.|
Human   283 EALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477
EH 18..83 CDD:238009
EH 184..279 CDD:197477
EH 195..261 CDD:238009
GBP_C <366..467 CDD:303769
TACC 369..570 CDD:282818
coiled coil 432..443 CDD:293879
coiled coil 457..467 CDD:293879
TBPIP <495..589 CDD:284512
SH3_Intersectin_1 674..728 CDD:212770
SH3_Intersectin_3 779..830 CDD:212772 13/69 (19%)
SH3_Intersectin_4 941..998 CDD:212773 13/56 (23%)
SH3_Intersectin_5 1025..1077 CDD:212774 23/51 (45%)
GRAP2NP_001278753.1 SH3_GRAP2_N 2..53 CDD:212880 13/48 (27%)
SH2_Grb2_like 54..147 CDD:199828 9/92 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..244 14/101 (14%)
SH3_GRAP2_C 275..327 CDD:212883 24/86 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.