DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and PIN3

DIOPT Version :10

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_015480.1 Gene:PIN3 / 856277 SGDID:S000006358 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:47/143 - (32%)
Similarity:70/143 - (48%) Gaps:14/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   753 DTYNDNINTSSIPA----ASADLTAA-GDVEYYIAAYPYESAEEGDLSFSAGEMVMVIKK-EGEW 811
            |.| |.|| .|:||    |:|...|: ..:||..|.|.::..::|||....|:.|.:::| ..||
Yeast    29 DVY-DQIN-KSLPAKWDPANAPRNASPASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEW 91

  Fly   812 WTGTIGSRTGMFPSNYVQKADVGTASTAAAEP-----VESLDQETTLNGNA-AYTAAPVEAQEQV 870
            :.|:...|||:||:|||:.|..|:...:...|     .:.|.|..|.|..| :|...|.......
Yeast    92 YKGSCNGRTGIFPANYVKPAFSGSNGPSNLPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTN 156

  Fly   871 YQPLPVQEPSEQP 883
            |...|.|:|.:.|
Yeast   157 YYQQPQQQPQQAP 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477
EH 184..279 CDD:197477
SMC_prok_B <368..>615 CDD:274008
SH3_Intersectin_1 674..728 CDD:212770
SH3_Intersectin_3 779..830 CDD:212772 20/51 (39%)
SH3_Intersectin_4 941..998 CDD:212773
SH3_Intersectin_5 1025..1077 CDD:212774
RRM_SF <1125..1175 CDD:473069
PIN3NP_015480.1 SH3 58..110 CDD:473055 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.