DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and ehd2

DIOPT Version :9

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_001025664.1 Gene:ehd2 / 595056 XenbaseID:XB-GENE-957213 Length:538 Species:Xenopus tropicalis


Alignment Length:258 Identity:65/258 - (25%)
Similarity:98/258 - (37%) Gaps:65/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PLILGQIWALADTDSDGKMNINEFSIACKLINLK--LRGMDVP-----------------KVLPP 93
            |.:.|:       |:..|..||:..:....|.|:  :...|.|                 ..|.|
 Frog   319 PSVFGK-------DNKKKQLINKLPVIFAKIQLEHHISPGDFPDCAKMQEQLAIHDFKKFHALKP 376

  Fly    94 SLLSS----LTGDVPSMTPRGSTSSLSPLDPLKGIVPAVAPVVPVVAPPVAVATVISPPGVSVPS 154
            .::.:    ||.|:..:.|......|...|.:                              |..
 Frog   377 HMIDALDEMLTVDIAKLMPLLRQEDLETCDNV------------------------------VQG 411

  Fly   155 GPTPPTSNPPSRHTSISERAPSIESVNQGEWAVQAAQKRKYTQVFNANDRTRSGYLTGSQARGVL 219
            |....|.|.|....|..   ...|.::..||.| ...|.||.::| .|.....|.:||::|:..:
 Frog   412 GAFDGTHNGPFIEGSTD---GIFEGLDDEEWVV-TKDKPKYDEIF-FNLAPTDGKITGTKAKNWM 471

  Fly   220 VQSKLPQVTLAQIWTLSDIDGDGRLNCDEFILAMFLCEKAMAGEKIPVTLPQEWVPPNLRKIK 282
            |.:|||...|.:||.|||:|.||.|:.:||.||..|.|..:.|..:|..||:..:||:.|:.|
 Frog   472 VTTKLPNSVLGKIWKLSDVDRDGMLDDEEFALASHLIEVKLEGHGLPPELPRHLIPPSKRRQK 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477 13/75 (17%)
EH 18..83 CDD:238009 8/36 (22%)
EH 184..279 CDD:197477 38/94 (40%)
EH 195..261 CDD:238009 27/65 (42%)
GBP_C <366..467 CDD:303769
TACC 369..570 CDD:282818
coiled coil 432..443 CDD:293879
coiled coil 457..467 CDD:293879
TBPIP <495..589 CDD:284512
SH3_Intersectin_1 674..728 CDD:212770
SH3_Intersectin_3 779..830 CDD:212772
SH3_Intersectin_4 941..998 CDD:212773
SH3_Intersectin_5 1025..1077 CDD:212774
ehd2NP_001025664.1 EHD_N <35..56 CDD:374864
EHD 60..300 CDD:206740
DUF5600 288..394 CDD:375591 15/81 (19%)
EH 438..531 CDD:197477 38/94 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.