DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dap160 and ehd2a

DIOPT Version :9

Sequence 1:	NP_001246118.1	Gene:	Dap160 / 35378	FlyBaseID:	FBgn0023388	Length:	1190	Species:	Drosophila melanogaster
Sequence 2:	XP_017211861.1	Gene:	ehd2a / 567055	ZFINID:	ZDB-GENE-060531-86	Length:	546	Species:	Danio rerio

Alignment Length:	106	Identity:	43/106 - (40%)
Similarity:	61/106 - (57%)	Gaps:	10/106 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 DAWAVTPRERLKYQEQFRALQPQAGFVTGAQAKGFFLQSQLPPLILGQIWALADTDSDGKMNINE 70
            |.|.|: :::.||.|.|..|.|..|.:||.:.|.:.|::.||..:||:||.|||.|.|||::..|
Zfish   441 DEWVVS-KDKAKYDEIFYNLSPHEGKLTGTKVKEWMLRTHLPSSVLGRIWKLADVDCDGKLDDEE 504

  Fly    71 FSIACKLINLKLRGMDVPKVLPPSLL---------SSLTGD 102
            |::|..||.:||.|..:|..||..||         |.:|.|
Zfish   505 FALAGHLIEVKLEGFGLPHELPTHLLPPSKRHRKNSEITDD 545

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dap160	NP_001246118.1	EH	7..101	CDD:197477	40/102 (39%)
		EH	18..83	CDD:238009	29/64 (45%)
		EH	184..279	CDD:197477
		EH	195..261	CDD:238009
		GBP_C	<366..467	CDD:303769
		TACC	369..570	CDD:282818
		coiled coil	432..443	CDD:293879
		coiled coil	457..467	CDD:293879
		TBPIP	<495..589	CDD:284512
		SH3_Intersectin_1	674..728	CDD:212770
		SH3_Intersectin_3	779..830	CDD:212772
		SH3_Intersectin_4	941..998	CDD:212773
		SH3_Intersectin_5	1025..1077	CDD:212774
ehd2a	XP_017211861.1	EHD_N	23..55	CDD:293485
		EHD	59..299	CDD:206740
		EH	442..535	CDD:197477	39/93 (42%)
		EH	452..517	CDD:238009	29/64 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170589264
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.840