DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and ehd2a

DIOPT Version :10

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:XP_017211861.1 Gene:ehd2a / 567055 ZFINID:ZDB-GENE-060531-86 Length:546 Species:Danio rerio


Alignment Length:106 Identity:43/106 - (40%)
Similarity:61/106 - (57%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DAWAVTPRERLKYQEQFRALQPQAGFVTGAQAKGFFLQSQLPPLILGQIWALADTDSDGKMNINE 70
            |.|.|: :::.||.|.|..|.|..|.:||.:.|.:.|::.||..:||:||.|||.|.|||::..|
Zfish   441 DEWVVS-KDKAKYDEIFYNLSPHEGKLTGTKVKEWMLRTHLPSSVLGRIWKLADVDCDGKLDDEE 504

  Fly    71 FSIACKLINLKLRGMDVPKVLPPSLL---------SSLTGD 102
            |::|..||.:||.|..:|..||..||         |.:|.|
Zfish   505 FALAGHLIEVKLEGFGLPHELPTHLLPPSKRHRKNSEITDD 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477 40/102 (39%)
EH 184..279 CDD:197477
SMC_prok_B <368..>615 CDD:274008
SH3_Intersectin_1 674..728 CDD:212770
SH3_Intersectin_3 779..830 CDD:212772
SH3_Intersectin_4 941..998 CDD:212773
SH3_Intersectin_5 1025..1077 CDD:212774
RRM_SF <1125..1175 CDD:473069
ehd2aXP_017211861.1 EHD_N 23..55 CDD:465295
EHD 59..299 CDD:206740
DUF5600 287..392 CDD:465667
EH 442..535 CDD:197477 39/93 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.