DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and CG9297

DIOPT Version :9

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_001262553.1 Gene:CG9297 / 41688 FlyBaseID:FBgn0038181 Length:952 Species:Drosophila melanogaster


Alignment Length:373 Identity:75/373 - (20%)
Similarity:134/373 - (35%) Gaps:98/373 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 DIDGDGRLNCDEFILAMFLCEKAMAGEKIPVTLPQEWVPPNLRKIKSRPGSVSGVVSRPGSQPAS 301
            |:||||..|..         ::.:.|:.:|               ..:...:.|           
  Fly   272 DLDGDGTNNSQ---------DEDLDGDGVP---------------NEKDDDLDG----------- 301

  Fly   302 RHASVSSQSGV-----GVVDADPTAGLPGQNKRKENYVKGQAELDRRRKIMEDQQRKEREERERK 361
                    .|:     |.||.|   |:|.::..|::......:.|       |....::|..:::
  Fly   302 --------DGILNEHDGDVDGD---GVPNEHDHKDSGENADDDDD-------DDDEDDKEAVKKR 348

  Fly   362 EREEADKREKARLEAERKQQEEL--------ERQLQRQREIEMEKEEQRKREL----EAKEAARK 414
            .:.|.|......:||.....||.        |...:.:.|:|..|||:.::|.    |.:.....
  Fly   349 SKREVDAAPVLDIEAPPSPAEEFPVEEEIVKEASAEEEAEVEAVKEEEPEQEAVQEPEPEPVVEP 413

  Fly   415 ELEKQR---QQEWEQARIAEMNAQKEREQERVLKQKAHNTQLNVELSTLN-EKIKELSQRICDTR 475
            |.|.|.   |||.|:|..||  |::|.:...|.:.:|....:..|.:... |.::|.:|......
  Fly   414 EAEVQPEPVQQEEEKAESAE--AKEEEKPAPVEEAEAEEESVQPEAAPKEPEAVQEEAQEDEPQT 476

  Fly   476 AGVTNVKTVIDGMRTQRDTSMSEMSQLKARIKEQNAKLLQLTQERAKWEAKSKASGAALGGENAQ 540
            .|..:.....|..:.:.:...........|.::...:||||.:|   :.|:.||:.         
  Fly   477 DGAQDAADDDDDTKPEDELLWEGHIPENRRSRQHITELLQLDEE---FNAREKATD--------- 529

  Fly   541 QEQLNAAFAHKQLIINQIKDKVENISKEIES--KKEDINTNDVQMSEL 586
                |.|    ::|:..||...||..|.:|:  |..|::.......|:
  Fly   530 ----NVA----EIILRDIKRIYENAVKPLETLYKYRDLSNRHFSDPEI 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477
EH 18..83 CDD:238009
EH 184..279 CDD:197477 8/41 (20%)
EH 195..261 CDD:238009 6/23 (26%)
GBP_C <366..467 CDD:303769 29/116 (25%)
TACC 369..570 CDD:282818 49/216 (23%)
coiled coil 432..443 CDD:293879 2/10 (20%)
coiled coil 457..467 CDD:293879 1/10 (10%)
TBPIP <495..589 CDD:284512 21/94 (22%)
SH3_Intersectin_1 674..728 CDD:212770
SH3_Intersectin_3 779..830 CDD:212772
SH3_Intersectin_4 941..998 CDD:212773
SH3_Intersectin_5 1025..1077 CDD:212774
CG9297NP_001262553.1 TSP3 repeat_long 167..205 CDD:275366
EHD_N 539..569 CDD:293485 8/29 (28%)
EHD 574..813 CDD:206740
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459014
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.